Below is the primary sequence of a viral protein. MSVVNTEIKFPTHLRSGDFAIIDGMVVEVTSVEYKPVEQAVYLKYRYHLHGNELSGSSLISAFKAVRTLEVP How many peptide bonds are present in this protein? Please write your answer as a number below
Below is the primary sequence of a viral protein.
MSVVNTEIKFPTHLRSGDFAIIDGMVVEVTSVEYKPVEQAVYLKYRYHLHGNELSGSSLISAFKAVRTLEVP
How many peptide bonds are present in this protein? Please write your answer as a number below.

Amino acids are biomolecules that are comprised of two functional groups, these are an amino group (-NH2) and a carboxyl group (-COOH). Amino acids when combined with a peptide bond, they form proteins. Proteins are macromolecules made up of L-amino acids. They are presently more than any other major macromolecules and perform various types of functions. Proteins are divided into four categories according to their structure, these are:
- Primary structure of proteins
- Secondary structure of proteins
- The tertiary structure of proteins
- Quaternary structure of proteins
Primary structure of proteins:
The linear chain of amino acids that forms the backbone of proteins or polypeptides is known as the primary structure of proteins. The functional part of DNA that codes for proteins carries a unique sequence of amino acids. It is possible due to the primary structure of the protein.
Trending now
This is a popular solution!
Step by step
Solved in 2 steps









