Which of the following bind to the motif GGAGG in human COLQ gene? SRSF1 hnRNPH Both None
Q: (osgnthesis
A: Retrosynthesis is a breaking down of targeting molecule by the process of ''breaking down '' a…
Q: What are the diseases a-ketoglutarate dehydrogenase deficiency, succinate dehydrogenase deficiency,…
A: ketoglutarate dehydrogenase: This is the enzyme that catalyses the conversion of alpha keto…
Q: In your own words, what do you think is/are the reason/s why most of the clinical features of these…
A: Krebs cycle disorders are a set of rare human diseases with a remarkable level of complexity when…
Q: Which of the following statements are correct? Explain your answers.A. An atomic nucleus contains…
A: Since the atom and nucleus were discovered. The bonding of a proton and a neutron, a proton and a…
Q: Determine the amino acids that compose the peptide shown below.
A: Amino acids are compounds with a carboxyl group and amino group attached to the same carbon atom.…
Q: 4. Draw the number of fragments as well as their sizes as they would migrate on the electrophoresis…
A: Sal1 is a restriction endonuclease i.e it cleaves DNA at the recognition sequence 5'-G/TCGAC-3'…
Q: Explain the Glycolysis and Kreb’s Cycle metabolic pathways.
A: Metabolic pathways in biochemistry are series of chemical reactions takes place which are linked…
Q: How many chromosomes are there in a body cell of a person with trisomy 21 condition? Select one: О…
A: Trisomy 21 is a genetic chromosomal disorder . Genetic chromosomal disorders are the diesese occurs…
Q: Fill out the following table:
A: Molecular biology is a field of biology which deals with studying the composition and interactions…
Q: 7. The standard free-energy change (in terms of net ATP production) when glucose is converted to 6…
A: All living organism except extremophiles metabolize carbohydrate particularly Glucose to meet up the…
Q: value the cathode or anode). Protein eins wards Pepsin Lysozyme Hemoglobin Mynolohin IpH 1.0 11.0…
A: On basis of the gel used, electrophoresis is classified into 2 types, Agarose gel…
Q: RBC metabolism pls explain as simple
A: RBCs are metabolically active , complex cells that used up glucose in order to generate ATP or…
Q: How does compromised pyruvate kinase activity lead to anemia? (3 sentences)
A: Pyruvate kinase is a glycolysis enzyme that plays a role in the last phase. It catalyzes the…
Q: Patient who had undergone a complex maxillofacial operation could not take food during 2 days, but…
A: Introduction: The level of blood glucose monitoring gives us insight into the effectiveness of the…
Q: 1. Which of the following is not true for the specificity of enzyme action? a) Specificity refers to…
A: Enzymes are proteins that assist the bodies speed up chemical processes. Enzymes are necessary for…
Q: RNA Pol III transcribes the following class of RNAS TRNAS rRNAs small nuclear RNAS All of the above
A: RNA pol III :- eukaryotic RNA polymerase, help in eukaryotic transcription.
Q: CH,O-P-o C=O 0. CH,O-P-o- CH-OH C=O Ó. HO-C-H H-C-OH H-C-OH O C-H of ČH;O-P-0- H-C-OH O CH;0-P-O 0.
A: Glycolysis is the metabolic pathway that converts glucose into pyruvic acid.
Q: . Using electron flow arrows, show electron transfer from nadh to fmn in complex 1 of the electron…
A: The electron transport (ETC) chain is coupled with ATP synthesis. ETC occurs in Cristea…
Q: 12 If strong-base anion exchange resin is applied to treat raw water with silicate, the pH of raw…
A: Note : Hi ! Thank you for the question. We are authorized to answer one question at a time. Since…
Q: . ) In one (1) sentence point out a key structural similarity and difference in each of the…
A: Nucleic acids are constituted of nucleotides linked via phosphodiester linkages while proteins are…
Q: Determine the number of carbon atoms present and the the total number of phosphate groups present in…
A: Glycolysis is a major metabolic pathway in the breakdown of carbohydrates such as glucose.…
Q: Rf Sample values A 0.21 В 0.39 C 0.33 0.27 Four amino acid samples were subjected to a normal-phase…
A: Normal phase chromatography is a type of adsorption chromatography which is used for analysis of…
Q: LLNSAMSRLYSLRSS 1.Assuming this sequnce is enitrely alpha helical what is the hydrogen bond donor…
A: The α-helix is an ordered secondary conformation of proteins. An α-helix is stabilized by the…
Q: 4. During a lunch at a McDonald's outlet, an office employee received about 350 g of carbohydrates…
A: for you. If you want a specific question to be answered then please specify the question number or…
Q: In the isolation of metabolites and tests for phytochemicals, why should people dry the leaves in…
A: Phytochemicals are compounds that are produced mostly by plants and have biological activity. Plants…
Q: 1. Shown below is a metabolic pathway: Es E4 E F E1 E2 E3 A - B C- E6 Q R S E7 E8 Suppose we have…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: Look at tho structuros of tho blood group dotorminante. Red blood cell N-Acetyl- D-glucosamine Blood…
A: Blood group antigens are O-glycoproteins, N-glycoproteins, and glycolipids that are present on the…
Q: Which of the following is a transition mutation? OC--> G OC --> T OC --> A
A: Transition is a point mutation where replacement of base pair occurs.
Q: 5. (a) Hexokinase IV is known as glucokinase (GCK) and is a central metabolic enzyme that…
A: Glucokinase (GCK) , the fourth isozyme version of Hexokinase (hence also called as Hexokinase IV) is…
Q: A glycogen polymer and an amylopectin polymer, each containing 100 monosaccharide subunits, are…
A: Amylopectin and glucogen are examples of branched polysaccharides.
Q: Loss of function mutation results in a _ allele.
A: Mutations are sudden changes in the gene sequence. When these changes causes loss of function of an…
Q: CH,0--o CH;0-P-O ČH-OH C=O Ó. 10-C-H H-C-OH H-C-OH O C-H ČH;O-P-0 H-C-OH O CH-O
A: Glycolysis is the metabolic pathway that converts glucose into pyruvic acid.
Q: How do you calculate RNA concentration?
A: DNA and RNA are made up of long chains of nucleotides. Sugar molecule, ribose in RNA, and…
Q: Sample Observation Remarks Albumin A Casein B Glycine C Tyrosine D
A: Ninhydrin test: This is a specific test for the identification of Amino acids, ammonia, primary /…
Q: Calculate the Keq (report up to two decimal places and do not use scientific notation) for the net…
A: The energetically unfavorable reactions having a positive delta G value is made possible ein the…
Q: 8. Which of these is not an example for stereo specificity? a) L-lactate dehydrogenase will act only…
A: Many enzymes can discriminate between enantiomeric substrates and such enzymes exhibit…
Q: HbA1c is a glycated hemoglobin in which a glucose molecule is covalently bound to the N-terminal…
A: Hemoglobin is an iron-containing oxygen-transport metalloprotein found in nearly all vertebrates'…
Q: Which of the following X-ray diffractograms was obtained from "wetter" DNA fibres?
A: X Ray diffraction is a nondestructive process which provides data about crystalline structure ,…
Q: Fill in the flow chart with the words/group of words from the box below to correctly trace the…
A: Carbohydrates are one of the important nutrient. Its major functions as a energy source, and also…
Q: Briefly describe "Lipids" and give examples
A: Lipids biological macromolecules non-polar molecules that is consist of hydrocarbons. It is soluble…
Q: how allosteric regulation is fundamentally different from competitive/uncompetitive/mixed inhibition…
A: Some categories of enzymes exhibit kinetic properties that cannot be studied using Michaelis-Menten…
Q: What is the relative activity and the degree of inhibition caused by a competitive
A: Enzymes are catalysts that speed up biochemical reactions (biological catalysts). Enzyme inhibitors…
Q: 4. Enzymes in an enzymatic reaction do not interfere with: a. free energy of reaction b. rate of…
A: Enzymes are the biological catalysts that speed up the rate of reaction by lowering the activation…
Q: How can these deficiencies (a-KG dehydrogenase, Succinate dehydrogenase (SDH), Fumarase) negatively…
A: The mentioned enzymes are the essential part of metabolic pathways that helps in synthesis and…
Q: With the aid of diagrams describe the signalling pathway involving inositol 1,4,5 trisphosphate from…
A: Membrane phospholipids can act as precursors from which second messengers can be produced during…
Q: 6. Which of the following is an example for broad substrate specificity? a) Chymotrypsin hydrolyzing…
A: Carbohydrates or carbs are maconutrient consisting of Carbon, hydrogen and oxygen atoms. In nature…
Q: The Lineweaver-Burke plots of a reaction without inhibitor and one with non-competitive inhibitor…
A: Enzymes are catalysts that enhance the rate of biochemical reactions.
Q: running the reaction at 83 °C cooling the reaction to 11 °C changing the pH to 5.4 Increase reaction…
A: The rate of an enzyme catalyzed reaction depends on various factors like temperature and pH of the…
Q: Calculate the free energy change for glucose entry into cells when the extracellular concentration…
A: Free energy change The change in free energy (ΔG) is basically the difference between the heat…
Q: Aldolase is a key enzyme in glycolysis that catalyzes the cleavage of its substrate,…
A: During glycolysis, Aldolase catalyzes the cleavage of its substrate fructose-1,6-bisphosphate into…
Step by step
Solved in 4 steps
- Polypeptides with the ER Signal Sequence (MMSFVSLLLVGILFTATEAEQLTKCEVFQ <- one-letter amino acid abbreviations) are targeted to the ER The ER Retrieval tag (KDEL) causes proteins to remain in the ER Protein Q has both an ER signal sequence and the ER retrieval tag.The following diagram depicts the elements at the: 999 2 cacc tata as tatafan A ACG TTC ATT BRE TATA box Inr DPE (TBP) TFIIB TFIID O Promoter Enhancer transcribed gene SilencerA fragment of a polypeptide, Met-Thr-Ile-Ser-Asp-Ile is encoded by the following sequence of DNA:Strand A - TACGATGACGATAAGCGACATAGC - Strand B - ATGCTACTGCTATTCGCTGTATCG -Which is the transcribed (template) strand? Write the sequence of the resulting mRNA transcript. Add labels to the strands above to show the 3’ and 5’ ends.
- Given the following coding strand of DNA: 3' – TACCGAGTACTGACT – 5', the MRNA that will transcribed from this gene is 5' fill in blank 3'.Consider the following mature mRNA from a human cell: 5' UAAUGUCGCAAUAACC 3¹ What is the sequence of amino acids in the translated protein? Second letter A First letter С U d A G บบบ UUC P U UUA UUG Leu CUU CUC CUA CUG GUU GUC GUA GUG -Phe Met-Ser-Gln Met-Arg-Lys-Ser Leu Stop-Cys-Arg-Asn-Asn C AUU AUC lle AUA ACA AUG Met ACG Val UCU UCC UCA UCG CCU CCC CCA CCG ACU ACC GCU GCC GCA GCGJ Ser Pro Thr Ala UAU UAC Tyr UGU UGC. UAA Stop UGA Stop UAG Stop UGG Trp CAC CAGGin CAU His Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. AAU Asn AAA Lys AAG. There is no start codon, resulting in no translated protein. GAU ASP GAC Glu GAA GAG G CGU CGC CGA CGG Cys AGU AGC AGA AGG Arg GGU GGC GGA GGGJ Arg ser Gly MCAG U UCAG с А SCAG U SCAG U Third letterWhich of the following is the LEAST likely ER signal sequence? All sequences are written with their N-terminus on the left. Met-Lys-Leu-Ser-Leu-Val-Ala-Ala-lle-Leu-Leu-Leu-Leu-Ser-Ala-Ala-Arg-Ala Met-Glu-Met-Phe-Gln-Gly-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Ser-Met-Gly-Gly-Thr-Trp-Ala Met-Lys-Ala-Lys-Leu-Leu-Val-Leu-Leu-Tyr-Ala-Phe-Val-Ala-Gly-Asn Met-Leu-Ser-Lys-Arg-Gln-Ser-Lys-Arg-Arg-Lys-Lys-Pro-Ala-Thr-Arg-Thr-Lys-Ser-Ser-Arg-Tyr-Leu
- What amino acid residues are phosphorylated on the intracellular domain of a VEGFR? What amino acid residues are phosphorylated on the intracellular domain of a VEGFR? Glutamic Acid Serine Tyrosine Valinehe Sequence below comes from the alpha-2 globin of the human hemoglobin gene cluster found in chromosome 16. The globin region of the hemoglobin protein itself consists of 2 alpha chains and 2 beta chains. 1 actcttctgg tccccacaga ctcagagaga acccaccatg gtgctgtctc ctgccgacaa 61 gaccaacgtc aaggccgcct ggggtaaggt cggcgcgcac gctggcgagt atggtgcgga 121 ggccctggag aggatgttcc tgtccttccc caccaccaag acctacttcc cgcacttcga 181 cctgagccac ggctctgccc aggttaaggg ccacggcaag aaggtggccg acgcgctgac 241 caacgccgtg gcgcacgtgg acgacatgcc caacgcgctg tccgccctga gcgacctgca 301 cgcgcacaag cttcgggtgg acccggtcaa cttcaagctc ctaagccact gcctgctggt 361 gaccctggcc gcccacctcc ccgccgagtt cacccctgcg gtgcacgcct ccctggacaa 421 gttcctggct tctgtgagca ccgtgctgac ctccaaatac cgttaagctg gagcctcggt 481 agccgttcct cctgcccgct gggcctccca acgggccctc ctcccctcct tgcaccggcc 541 cttcctggtc…Which of the following polypeptides (written from their N terminal ends) is encoded by the following mRNA? (hint: there is no left or write in a cell!) 3' GG AUG AGU AUA CUU ACG GGU GAA GUA CAU UAA CCC C5' O O O Met Lys Trp Ala Phe lle Met Ser lle Leu Thr Gly Glu Val His Tyr Lys Arg Thr Phe Tyr Met none of the above His Val Glu Gly Thr Leu lle Ser Met
- These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIVA segment of a polypeptide chain is Arg-Gly-Ser-Phe-Val-Asp-Arg. It is encoded by the following segment of DNA: GGCTAGCTGCTTCCTTGGGGA CCGATCGACGAAGGAACCCCT Note out the mRNA sequence generated by the template strant to produce that polypeptide chain Label each stran with its correct polarity (5' and 3' ends on each strand)Which set of fragment ions is likely from the same population of precursors ions (parent peptide) from Covid-19 spike protein? b ion NFYEPQI+ and y ion +EPQIITTDK b ion VNNTVYDIP+ and y ion +NNTVYD b ion PLSETK+ and y ion +ALDP All of the described choices are likely. None of the described choices are likely.
