1- Describe any errors in your technique. How could you improve upon your technique in order to get a better and more accurate standard curve graph? 2-Estimate (from your data) the [Protein] of your unknown (0.103) based on comparing to the standards. Include the correct unit. This estimate should be an integer (no decimals).

Q: Distinguish the two methodologies used for getting a complete protein structure. Will the structural…

A: Proteins are essential for every cellular process occurring in a biological system as they control…

Q: What is a Ramachandran Plot?

A: Ramachandran plot is developed by G N Ramachandran, C Ramakrishnan and V Sasisekharan in 1963. This…

Q: Subject: Biochemistry, chemistry, polyacrylamide gel electrophoresis Differentiate native PAGE and…

A: PAGE/SDS-PAGE are the electrophoretic techniques used for protein separation

Q: 13. Shape and dimension. (a) Tropomyosın, a 70-kDa muscle protein, is a two-stranded a-helical…

A: Secondary structure of protein: Formed due to twisting of the polypeptide chain.The folding is due…

Q: How could you improve upon your technique in order to get a better and more accurate standard curve…

A: A standard curve have the Absorbance values at a particular wavelength  (Absorbance at 595nm  i.e.…

Q: You have prepared a BSA serial dilution (ug ml) to construct a protein standard curve, for which the…

A: The standard equation for calculating concentration is Beer Lambert's law, A= ebc, where A is…

Q: 3. Estimate th spherical

A: Introduction: Amino acids make up the macromolecule known as protein. Proteins are essential for…

Q: Design an assay with purified phycocyanin to test protein stability using 500ml of 95% ethanol. Then…

A: Phycocyanin is a pigment that is found in cyanobacteria and algae. It’s a member of the…

Q: SDS-poly- acrylamide slab Protein spot Two-dimensional gel electrophoresis is used to separate and…

A: Gel electrophoresis is a method employed for isolating DNA fragments or proteins based on their…

Q: A group of absent-minded scientists has two numbers (25.4 and 2.54) written on a scrap of paper. One…

A: Standard deviation is a statistical measure of the amount of variation or dispersion of a set of…

Q: Define the term pI, describe its meaning and how it could be used to separate proteins using a 2D…

A: Amino acids have both acidic (COOH) and basic (NH2) groups. They can donate or accept a proton,…

Q: How can I calculate the molecular weight of the unknown protein on this sample using the SDS-PAGE…

A: Electrophoresis of proteins is generally carried out in gels made up of the cross linked polymer…

Q: If you have the following proteins? Protein MW, kDa 67 pl 3.5 A В 45 7.3 C D 45 5.0 14.5 7.3 E 67…

A: Proteins B and D have the same PI. However there is a considerable difference in the size of these…

Q: As an example, consider albumin, a protein made of a single polypeptide weighing 66,000 daltons (66…

A: Gel electrophoresis if the technique of separation of molecules on the basis of their size and…

Q: Define about sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE)? Explain…

A: The process aims at the separation along with the analysis of the macromolecules that include…

Q: Using the equation for the best-fit straight line through your data, the average absorbance of your…

A: Beer-Lambert's law states that the amount of energy absorbed or transmitted by a solution is…

Q: The free energy of folding of a protein is -17kJ/mol. What tenoerature (C) do you have to heat the…

A: Protein folding is related to protein stability that is the thermodynamic stability, not the…

Q: List 4 advantages of biological value of protein determination method.

A: Protein structure involves three-dimensional structure and arrangement of the sequence of amino…

Q: Compare and contrast the following protein characterization techniques in terms of the principles…

A: Precipitation happens when the pH or hydrophobicity of a protein affects interactions with the…

Q: n SDS PAGE the resolving gel :   is 4%(w/v) acrylamide,PH )6.8   is 6-20% (w/v) acrylamide…

A: SDS PAGE stands for Sodium Dodecyl Sulphate Poly-Acrylamide Gel Electrophoresis. It is a technique…

Q: Activity 1 Activity 2 Activity 3 Activity 4

A: Role of nucleic acid in COVID-19 testing? - Technique such as RT-PCR falls under the category of…

Q: The following list of proteins are found in a mixture and are to be separated by 2D gel…

A: In 2D gel electrophoresis, is a 2 step-based separation of protein.  In the first dimension, the…

Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…

A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…

Q: A C2 G This a photograph of an actual polyacrylamide gel that has been run with samples of protein.…

A: Note: Hi! Thank you for the question. We are authorized to answer three subparts at a time. Since…

Q: Several calibration curves were created for a series of protein standards of known molecular mass…

A: Introduction :- Chromatography is a laboratory method used in chemical analysis to separate a…

Q: In isoelectric focusing, a protein sample is applied at the end of a gel with an immobilized pH…

A: In isoelectric focusing, a protein sample is applied at the end of a gel with an immobilized pH…

Q: Protein purification schemes typically involve several techniques. For the techniques listed below…

A: Proteins perform a wide variety of activities, which is enabled by the diversity of amino acid…

Q: 2.) An unknown amino acid was subjected to paper chromatography with five amino acid standards in…

A: For Thin layer chromatography, we define Retension factor (Rf) as ratio of distance travelled by…

Q: Part C-Cold dentauration In the lecture, we observed that the protein stability curve as described…

A: Newton Raphson method is used to find solutions of any function. It is given by the…

Q: 7. Imagine you're purifying a protein with a pl of 6.5 that has a 6-Histidine tag from E. coli…

A: Ni-NTA agarose is an affinity chromatography matrix that is used for the purification of recombinant…

Q: What would the net charge be of a polypeptide with the sequence M-D-R-N-Q-K at pH 8? hint ionizable…

A: The given polypeptide is M-D-R-N-Q-K M = Methionine D = Aspartic aicd R = Arginine N = Asparagine Q…

Q: A student conducted an experiment on protein isolation from mungbean. After isolating the protein,…

A: Bradford assay is an example for a general protein assay. It is used to quantify the unknown amount…

Q: When given a purification table that contains the total protein, protein conc., the specific…

A: Proteins are purified by using different chromatography techniques such as hydrophobic interaction…

Q: Under the stated conditions, the majority of the protein molecules in solution would be

A:

Q: What kind of information is stored in protein three-dimensional structure. Why 3D structure…

A: Amino acids Proteins are the polymers of nitrogenous compounds called amino acids. Each amino acid…

Q: Which of the following statements is FALSE regarding proteins? The three-dimensional shape of a…

A: The three-dimensional shape of a protein is critical for the functioning of that protein. (TRUE)…

Q: Make an analysis of the electrophoresis data below. Comment on the purity, number of subunits, and…

A: Native gel electrophoresis is the process of separation without adding any denaturing agent like…

Q: Mass spectrometry and X‑ray diffraction are common biochemical techniques for characterizing…

A: In order to determine the mass-to-charge ratio (m/z) of one or more molecules found in a sample,…

Q: Define the following terms: a. autocrine b. triacylglycerol c. neutral fat d. fat e. oil

A: Biomolecules or biological molecules are any of the numerous substances that are produced by cells…