Concept explainers
(1)
To define:
The health-care associated infection.
Case summary:
In the given summary, an 85-year-old lady was hospitalized after she broke her hip by falling in the bathroom. She had a series of complications and her treatment is necessitated by a urinary catheter, a feeding tube, and an intensive antibiotic therapy. She acquired a life-threatening urinary tract infection along with the multi-drug resistant Enterococcus faecium. The patient lost her life even though she was treated with antimicrobial drugs including penicillin, metronidazole, ciprofloxacin, erythromycin, and vancomycin.
(2)
To determine:
What is the likely source of the patient’s infection.
Case summary:
In the given summary, an 85-year-old lady was hospitalized after she broke her hip by falling in the bathroom. She had a series of complications and her treatment is necessitated by a urinary catheter, a feeding tube, and an intensive antibiotic therapy. She acquired a life-threatening urinary tract infection along with the multi-drug resistant Enterococcus faecium. The patient lost her life even though she was treated with antimicrobial drugs including penicillin, metronidazole, ciprofloxacin, erythromycin, and vancomycin.
(3)
To determine:
List three ways through which E. faecium acquires drug resistant genes.
Case summary:
In the given summary, an 85-year-old lady was hospitalized after she broke her hip by falling in the bathroom. She had a series of complications and her treatment is necessitated by a urinary catheter, a feeding tube, and an intensive antibiotic therapy. She acquired a life-threatening urinary tract infection along with the multi-drug resistant Enterococcus faecium. The patient lost her life even though she was treated with antimicrobial drugs including penicillin, metronidazole, ciprofloxacin, erythromycin, and vancomycin.
(4)
To determine:
How the hospital personnel could prevent the spreading of resistant E. faecium all over the hospital.
Case summary:
In the given summary, an 85-year-old lady was hospitalized after she broke her hip by falling in the bathroom. She had a series of complications and her treatment is necessitated by a urinary catheter, a feeding tube, and an intensive antibiotic therapy. She acquired a life-threatening urinary tract infection along with the multi-drug resistant Enterococcus faecium. The patient lost her life even though she was treated with antimicrobial drugs including penicillin, metronidazole, ciprofloxacin, erythromycin, and vancomycin.
Want to see the full answer?
Check out a sample textbook solutionChapter 7 Solutions
Microbiology with Diseases by Body System (5th Edition)
- Match the statement with the correct term Statement- -A group of HFr bacteria is mixed with a group of F– bacteria. After several days, the F- bacteria contain part of the Hfr chromosome -The uptake of DNA into a bacterium from its environment -Requires the presence of a plasmid -uses bacteriophage to provide new genetic information Terms- -transduction -conjugation -translation -transformation -transpositionarrow_forwardPlease make this as SIMPLE as possible Question: regarding to horizontal gene transfer please only discuss what cells are still alive or dead between transformation, trasnduction, and conjugation Be specific when discussing the donor versus recipient cell, and if the donor and recipient cells are still alive after each horizontal gene transfer event is completearrow_forwardUsing figure (a) above as guide, list the five components in the CRISPR-Cas9 bacterial defense system used against bacteriophage infection. In 25 words or less describe the role of each component of the system. (1) (2) (3) (4) (5)arrow_forward
- Question: Gene therapy: a) what disease is it used for? b) what genetic defect causes the disease? c) what and how viral vector is used AND/OR CRISPR-Cas is used? d) what is in the horizen re. development of new virus-based gene delivery vesicle?arrow_forwardYou identify a new bacterial species in the koi pond between the Curry Student Center and Robinson Hall and decide to name it NE koili. You analyze the genome sequence of NE koili and find that the NE koili genome contains cas genes and pieces of various bacteriophage genomes separated by unique repeats. You roommate is baffled by this observation. Having covered this topic in BIOL2299, explain to your roommate why there are pieces of phage DNA in a bacterial genome. In your answer, include the role of cas nuclease.arrow_forwardplease helparrow_forward
- The words at the bottom with commas are the answer choices or word bankarrow_forwardThis quarter in lab, you have studied two different technologies that allow us to modify the genome of a cell: transformation and CRISPR. In your own words, briefly describe two differences between these technologies. (For example, these can be differences between their outcomes, procedures, reagents, or something else.) Please respond in 2-4 sentences.arrow_forward9. Please help answer this question and please show all work on how you got the answers. Thank you so much!! :)arrow_forward
- Coronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…arrow_forwardThe COVID-19 vaccines are RNA-based (the RNA codes for a viral antigen). Nucleic acid-based vaccines have been discussed for awhile, but I was surprised that the companies decided on an RNA-based vaccine instead of a DNA-based one (given the instability of RNA compared to DNA). Use your knowledge of molecular biology to discuss the advantages of an RNA-based vaccine over a DNA-based vaccine.arrow_forwardPlease help me with this question ASAP within an hour with complete answer ?arrow_forward
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax