Concept explainers
Interpretation:
If it is appropriate to call NPY the obesity-promoting hormone should be explained. The
Concept introduction:
People sometimes assume that since NPY stirred food intake it might result in increase weight and over time obesity. However, some scientists Levens and Della-Zuana, during a review, conduct analysis on NPY and NPY receptors in (Current Opinion in Investigate medication (2003) 1198-204). They come to know that NPY has not supportably complete a task in obesity once the amount of NPY decrease with antibodies.
Want to see the full answer?
Check out a sample textbook solution- Compare the G protein Gs, which acts in transducing the signal from β-adrenergic receptors, and the G protein Ras. What properties do they share? How do they differ? What is the functional difference between Gs and Gi?arrow_forwardHow would a mutation in ras that leads to formation of a Ras proteinwith no GTPase activity affect a cell’s response to insulin?arrow_forwardNormally, when blood glucose level increases (e.g. after a meal), the islet cells in the pancreas secrete insulin. When insulin molecules bind to insulin receptors on the surface of a muscle cell, the receptors become activated, initiating a signaling pathway which eventually results in the increase in the number of passive glucose transporter on the muscle cell surface thus increases the uptake of glucose into the cell and decrease blood glucose level. Indicate whether the following conditions/practice will likely lead to diabetes (mark Yes or No). [Select] degeneration of islet cells [Select] [Select] [Select] a mutation in the insulin receptor that increases its kinase activity ✓ exercise a mutation in the insulin receptor that prevents dimerizationarrow_forward
- Suppose that, through genetic manipulations, a chimeric receptor is produced that consists of the extracellular domain of the insulin receptor and the transmembrane and intracellular domains of the EGF receptor. Cells expressing this receptor are exposed to insulin, and the level of phosphorylation of the chimeric receptor is examined. What would you expect to observe and why? What would you expect to observe if these cells were exposed to EGF?arrow_forwardThere are several congenital disorders of fructose metabolism resulting from a variety of enzyme deficiencies. These patients have difficulty using fructose for a variety of reasons, of course depending on the specific deficient gene product. Fructose is regularly consumed by humans because of their omnivorous diet that includes fruits (…and other sweets). FBPase-1 deficiency is one example of a deficiency that leads to a disorder of fructose metabolism. Explain why these patients present with hypoglycemia and lactic acidosis during fasting. Which one of these will work to treat a FBPase-1 deficient patient and which one will not? Treatments: Lactose Sucrose Ribose Glycerolarrow_forwardDominant mutations in the Akt gene have been identified that lead to gain- of-function phenotypes. In these children, the Akt protein has a E17K mutation, which results in the Akt protein being phosphorylated by PDK1 in the absence of insulin signaling. It is observed in these patients that the GRB2 pathway is also activated in the absence of insulin. Predict two symptoms in these patients resulting from activation of insulin signaling in the absence of insulin. Prefix definitions; hypo= below, hyper = above. 1) Severe fasting hyperglycemia, 2) Abnormal tissue hypergrowth 1) Insulin resistance in muscle, 2) Abnormal tissue hypergrowth 1) Severe fasting hypoglycemia, 2) Abnormal tissue hypogrowth 1) Severe fasting hyperglycemia, 2) Defect in insulin secretion 1) Severe fasting hypoglycemia, 2) Abnormal tissue hypergrowtharrow_forward
- Design a pair of primers to amplify the human Insulin gene (only the blue region) Human Insulin CDNA (gene sequence, 5'-untranslated region, 3'-untranslated region) 5'agecete agccctccaggacaggctgcatcagaagaggccatcaagcagatcactgtccttctgccATGGCCCTGTGGA TGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGACCCAGCCGCAGCCTTTGTGAACCAAC АССТСTGCGGCTCАCАCСТGGTGGAAGCTCTCТАССТАGTGTGCGGGGAACGAGGCTTCTTCTACАCACСCА AGACCCGCCGGGAGGCAGAGGACCTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCC TGCAGCCCTTGGCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGCT CCCTCTACCAGCTGGAGAACTACTGCAACTAGacgcagcccgcaggcagccccccacccgccgcctcctgca ccgagagagatggaataaagcccttgaaccaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaŋ' Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN* 5'-C 5'-I ]-3' ]-3' Primer: I Primer: 2 I know the answers are 5'-ATGGCC-3' for primer 1 and 5'-CTAGTT-3' for primer 2 but I'm not sure why. Could some explain why?arrow_forwardMutations to SRP72 (the RNA component of the signal recognition particle) are known to cause some forms of familial bone marrow failure. Which of the following protein(s) is/are potentially affected by such deleterious mutations? Choose all that apply Epidermal growth factor receptor (EGFR) Cytochrome c Insulin (a secreted protein) uS7 (a small ribosamal subunit protein from all dornains of life) DO00arrow_forwardDiscuss the advantages and disadvantages of using genetic engineering to produce human insulin.arrow_forward
- Explain the basics of a disease involving a breakdown in the structure/function of a receptor and/or intracellular targets involved in a signal transduction pathway. Describe some of these diseases in the table below:arrow_forwardPhosphofructokinase (PFK) catalyzes a key step in glycolysis. This enzyme is composed of three distinct subunits, muscle (M), liver (L) and platelet (P), which are expressed in different tissues. Mature human muscle contains exclusively the M isoform, while red blood cells express both M & L subunits. PFK gene mutations lead to M protein deficiency, intolerance to vigorous exercise and may lead to hemolytic anemia (Tarui disease). Which of the following can you conclude from the above information? Select all that apply. The muscle cells will be able to generate ATP through oxidative phosphorylation in the presence of oxygen U There may be a total lack of PFK activity in muscle O The red blood cells will be able to generate ATP through oxidative phosphorylation in the presence of oxygen U Hemolytic anemia may be due to instability of the L subunits in red blood cellsarrow_forwardBriefly describe why there could be a possible link between TAS2R38 sensitivity and obesity. In your own words, formulate a summary (background, aim, method, results, conclusion) of a published study on obesity and taste receptors in your answer.arrow_forward
- BiochemistryBiochemistryISBN:9781305577206Author:Reginald H. Garrett, Charles M. GrishamPublisher:Cengage Learning