Human Physiology: From Cells to Systems (MindTap Course List)
9th Edition
ISBN: 9781285866932
Author: Lauralee Sherwood
Publisher: Cengage Learning
expand_more
expand_more
format_list_bulleted
Concept explainers
Question
Chapter 2.3, Problem 1CYU
Summary Introduction
To determine:
The differences between rough ER and smooth ER.
Introduction:
Endoplasmic Reticulum is an intricate fluid-filled membranous system which is widely distributed throughout the cytosol. It is generally a lipid and protein producing factory. Two forms of endoplasmic reticulum are present − roughER and smooth ER.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
Explain LINEs (long interspersed elements) and SINEs (short interspersedelements)?
What is an SMC complex? Describe two examples
Explain the one turn/two turn joining (12/23; heptamer/nonamer) rule for VL to JL, DH to JH, and VH to DHJH joining.
Chapter 2 Solutions
Human Physiology: From Cells to Systems (MindTap Course List)
Ch. 2.1 - State the principles of the cell theory.Ch. 2.1 - Prob. 2CYUCh. 2.2 - State the functions of DNA and the different types...Ch. 2.2 - Prob. 2CYUCh. 2.2 - Prob. 3CYUCh. 2.3 - Prob. 1CYUCh. 2.3 - Discuss the structure and function of a ribosome.Ch. 2.3 - Prob. 3CYUCh. 2.3 - Prob. 4CYUCh. 2.4 - Describe the structure and functions of a Golgi...
Ch. 2.4 - Prob. 2CYUCh. 2.4 - Prob. 3CYUCh. 2.5 - Prob. 1CYUCh. 2.5 - Prob. 2CYUCh. 2.5 - Prob. 3CYUCh. 2.6 - Prob. 1CYUCh. 2.6 - Prob. 2CYUCh. 2.7 - Prob. 1CYUCh. 2.7 - Prob. 2CYUCh. 2.7 - Prob. 3CYUCh. 2.7 - Prob. 4CYUCh. 2.8 - Prob. 1CYUCh. 2.8 - Prob. 2CYUCh. 2.9 - Prob. 1CYUCh. 2.9 - Prob. 2CYUCh. 2.10 - List the three types of cytoskeletal elements and...Ch. 2.10 - Explain how motor proteins transport proteins...Ch. 2.10 - Prob. 3CYUCh. 2.10 - Prob. 4CYUCh. 2 - Prob. 1RECh. 2 - Prob. 2RECh. 2 - Prob. 3RECh. 2 - Prob. 4RECh. 2 - Prob. 5RECh. 2 - Prob. 6RECh. 2 - Prob. 7RECh. 2 - Prob. 8RECh. 2 - Prob. 9RECh. 2 - Using the answer code on the right, indicate which...Ch. 2 - Prob. 11RECh. 2 - Prob. 1UCCh. 2 - Prob. 2UCCh. 2 - Prob. 3UCCh. 2 - Compare exocytosis and endocytosis. Define...Ch. 2 - Prob. 5UCCh. 2 - Compare lysosomes with peroxisomes.Ch. 2 - Distinguish among cellular respiration, oxidative...Ch. 2 - Prob. 8UCCh. 2 - Prob. 9UCCh. 2 - Cells expend energy on what three categories of...Ch. 2 - Prob. 11UCCh. 2 - Prob. 1SQECh. 2 - Prob. 2SQECh. 2 - Prob. 3SQECh. 2 - Calculate the number of cells in the body of an...Ch. 2 - Prob. 5SQECh. 2 - Applying Clinical Reasoning Kevin S. and his wife...Ch. 2 - The stomach has two types of exocrine secretory...Ch. 2 - Prob. 2TAHLCh. 2 - Prob. 3TAHLCh. 2 - Why do you think a person is able to perform...Ch. 2 - Prob. 5TAHL
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- What is the key difference between interphase and interkinesis? When does interkinesis occur?arrow_forwardThree polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?arrow_forwardDescribe how a carrier protein functions. What role do carrier proteins serve in the cell? Why are they necessary? Where might you find a carrier protein?arrow_forward
- List the two mechanisms found in cells that selectively alter protein shape?arrow_forwardDescribe the relationships between Ras, Jun, and Fos.arrow_forward(b) Hemoglobin is made of B-globin subunits. The first few mRNA nucleotides for B- globin are given by: (1) (iii) (iv) Write down the DNA sequence that has led to this mRNA and indicate the sense and non-sense strands and the polarity. CE Derive the polypeptide for the sequence using the table of the genetic code (Table Q1 below) and indicate the polarity of the polypeptide chain. First Position (5' end) U A single point mutation in mRNA sequence can cause sickle cell anemia by changing the amino acid Glu to Val. For the given mRNA, indicate the point mutations for the first Glu in the polypeptide sequence that can cause this disease. 5'-AUGGUCCACCUGACUCCUGAGGAGAAG...UGA-3' C The polypeptide of B-globin contains the amino acid Leu. Write down all the anticodons of the tRNA molecules that can potentially code for Val. Indicate the polarity of the anti-codon. A G Table 1. The Codons of the Genetic Code Second Position U Phe Phe Leu Leu Leu Leu Leu Leu Ile Ile Ile Met-Start Val Val Val…arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Physiology: From Cells to Systems (MindTap ...BiologyISBN:9781285866932Author:Lauralee SherwoodPublisher:Cengage LearningBiology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage LearningAnatomy & PhysiologyBiologyISBN:9781938168130Author:Kelly A. Young, James A. Wise, Peter DeSaix, Dean H. Kruse, Brandon Poe, Eddie Johnson, Jody E. Johnson, Oksana Korol, J. Gordon Betts, Mark WomblePublisher:OpenStax College
- Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Human Physiology: From Cells to Systems (MindTap ...
Biology
ISBN:9781285866932
Author:Lauralee Sherwood
Publisher:Cengage Learning
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
Anatomy & Physiology
Biology
ISBN:9781938168130
Author:Kelly A. Young, James A. Wise, Peter DeSaix, Dean H. Kruse, Brandon Poe, Eddie Johnson, Jody E. Johnson, Oksana Korol, J. Gordon Betts, Mark Womble
Publisher:OpenStax College
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
The Sensorimotor System and Human Reflexes; Author: Professor Dave Explains;https://www.youtube.com/watch?v=M0PEXquyhA4;License: Standard youtube license