Answered: Which membranes can proteins…

Which membranes can proteins translocate across when they are being sorted/transported in a cell? Remember, there are three main ways proteins travel throughout a cell

Anatomy & Physiology

1st Edition

ISBN:9781938168130

Author:Kelly A. Young, James A. Wise, Peter DeSaix, Dean H. Kruse, Brandon Poe, Eddie Johnson, Jody E. Johnson, Oksana Korol, J. Gordon Betts, Mark Womble

Publisher:Kelly A. Young, James A. Wise, Peter DeSaix, Dean H. Kruse, Brandon Poe, Eddie Johnson, Jody E. Johnson, Oksana Korol, J. Gordon Betts, Mark Womble

Chapter3: The Cellular Level Of Organization

Section: Chapter Questions

Problem 6RQ: Because they are embedded within the membrane, ion channels are examples of ________. receptor...

See similar textbooks

Related questions

Q: 11. Treatment of disrupted erythrocyte membranes with a concentrated salt solution released an…

A: Hope it answer your questions. Let me know if you have any clarification. Thank you.

Q: 3. Design an experiment to determine whether a protein is an ion channel or a transporter. Provide…

A: Membrane transport involves the movement of ions/macromolecules across the membrane via…

Q: Why will you reconstitute the receptor into a lipid bilayer?

A: G-protein coupled receptor - It is also termed as 7 pass transmembrane domain receptor. this get…

Q: A scientist is about to develop a program to predict the presence of an alpha-helix trans-membrane…

A: Alpha-helix is a spiral-like secondary structure of proteins stabilized through intra-molecular…

Q: a. Simple Diffusion b. Facilitated diffusion by a channel protein c. Facilitated diffusion by a…

A: Introduction Diffusion is a process by which molecules or ions move from regions of higher to lower…

Q: Glucose is taken up by red blood cells by binding to a specific pocket in a membrane protein which…

A: Membrane transport mechanism is a phenomenon which provides the information regarding the movement…

Q: Discuss the preferred locations of different classes of amino acids in transmembrane proteins.

A: The integral proteins that are present in the cell membrane are known as transmembrane proteins…

Q: 6. Sort the following molecules based on their rate of diffusion across the phospholipid bilayer in…

A: The phospholipid bilayer is made up of two phospholipid layers: an internal layer that repels water…

Q: . Working as an engineer in the R&D section of a biotech industry, you are asked to select a…

A: The membrane technology covers all engineering approaches for the transport of substances between…

Q: Choose the statements that describe how the helix orients in the tertiary structure of an integral…

A: Plasma membrane is made up of mainly phospholipid and protein. Membrane protein can be classified as…

Q: In 1970, Frye and Edidin published research describing the mobility of plasma membrane proteins.…

A: Microscopy involves the usage of microscope to visualize the things that are not seen with an…

Q: +H₂N-CH-COO™ 1 CH₂ I CH₂ I CH₂ I +H₂N-CH₂ A. amino acid D O amino acid B amino acid C O amino acid A…

A: Amino acids are biomolecules that have a hydrogen atom, an amino group and a carboxyl group linked…

Q: Proteins attached to the outer half of the plasma membrane bilayer are usually attached by…

A: Biological macromolecules are those large molecules that are essential to carry out important…

Q: 7. We can estimate the relative mobility of a population of molecules along the surface of a living…

A: D) FRAP (Fluorescence Recovery After Photobleaching) is a technique used to study the mobility of…

Q: A researcher is isolating proteins from a cell via different techniques. They find that when the…

A: Establishing protein expression is important in the study of cells, because proteins often carry out…

Q: 4. Salt is one of the oldest methods of food preservation. Examples of this method include cured…

A: Salt is one of the oldest methods of food preservation and it works by drawing out moisture from the…

Q: Choose the correct order of events for protein synthesis of an INTEGRAL MEMBRANE PROTEIN. 1.…

A: Gene expression is the process by which information from a gene is used in the synthesis of a…

Q: A nickel containing transmembrane protein ____

A: There are a few important points : Membrane proteins are responsible for most of the dynamic…

Q: 1. The Size of Cells and Their Components A typical eukaryotic cell has a cellular diameter of 50…

A: Electron microscope is an instrument to measure the ultrastructure of microscopic biological and…

Q: 6. Predict which of the following amino acids will be found in the transmembrane domain of an…

A: The portion of a protein that spans the lipid bilayer of a biological membrane is referred to as the…

Q: 3. Some proteins are membrane bound and have segments (called transmembrane domains) that pass…

A: There are different proteins associated with lipid bilayer and they perform different functions.…

Q: Can someone please explain in technical detail how all the proteins in the Outer Membrane Proteins…

A: INTRODUCTION Proteins are essential to life. They are macromolecules made up of smaller units called…

Q: 10. As described by the fluid mosaic model, biological membranes contain not only phospholipids but…

A: Cell membrane is a phospholipid bilayer with some integrated proteins. Proteins that span through…

Q: Explain the role that cytoskeleton plays in the cellular biomechanics. What are the ( different…

A: The cytoskeleton of the cells the structural support to help in maintaining the cell shape and…

Q: 15 Which of the following amino acids would most likely be present in the boxed section, assume…

A: A protein is made of a polypeptide chain of amino acids and every amino acid is of different…

Q: 1. Flip-Flop is considered the LEAST likely to happen of the four membrane movements because it is…

A: Introduction : phospholipis are the most abundant lipid found in membrane. Lipids show different…

Q: Suppose that you joined a group of scientists working with a multipass ER-resident membrane protein.…

A: The transport of newly synthesized proteins to their destined cellular part is known as Protein…

Q: Having made it through Cell Molecular Biology this far, you are now an expert on cells and their…

A: Proteins are polymers made of amino acids as monomeric units. There are 20 different amino acids…

Q: Protein modifications that involve disulfide bonds occur in the following;(there may be more than…

A: Proteins are the basic building components of our bodies. They are big and complicated…

Q: 12. Molecules can be transported across cell membranes in several ways. Compare and contrast the…

A: ****Note: since you have posted multiple questions so we will solve the first question for you. We…

Q: 8. Phosphate buffered saline (PBS) is often used as an isotonic solution to keep cells happy and…

A: Osmosis is the movement of water across the semipermeable membrane driven by the difference in…

Q: The cytosol contains free, unattached ribosomes. Another location in which ribosomes may be found…

A: The cell is the structural and functional unit of life. It contains several organelles floating in…

Q: 3. Here is a question that test your ability to understand and combine concepts. hydropathy index I.…

A: I. Would you predict this protein to contain transmembrane helices? If so, how many? Hydropathy plot…

Q: The amino acid of a transmembrane protein was analyzed with a hydrophobicity (Kite-Doolittle) plot…

A: The plasma membrane of the cell consists of any number of biomolecules and proteins embedded in it.…

Q: Now talk about how it affects newly synthesized proteins, SUMOylation impacts protein and protein…

A: There are many post-translational modifications to proteins that alter cellular activity including…

Q: Suppose that you joined a group of scientists working with a multipass ER-resident membrane protein.…

A: Multipass transmembrane proteins are those which span the membrane multiple times. The region of…

Q: 1-what are the largest element of the cytoskeleton and can dynamically grow and shrink by the…

A: Note- According to the guidelines, we are supposed to solve only 1 question, please post the other…

Q: movement of tRNAs

A: Answer: It is necessary to place three known sites within the ribosome, A (aminoacyl), P (peptidyl),…

Q: integral memebrane protein that crosses membrane multiple time b. lipid-linked membrane proteins…

A: Hydropathic index identifies what kind of residues are present in a protein whether it is made up of…

Q: Consider the amino acids on the image below. Which of the following amino acids would be most likely…

A: Protein is an essential macronutrient. It is found throughout the body of living beings in muscle,…

Q: 1. Predict the membrane orientation of a protein that is synthesized with the following features:…

A: The insertion of membrane proteins in their right orientation is decided by multiple sequences that…

Q: A main function of the cell membrane is to be very selective as to what is able to cross through, a…

A: The cell membrane is the outer membrane found in the cell of most organisms. It is believed that the…

Q: Consider the membrane protems in question 7. What cellular functions must always be performed by an…

A: Integral membrane Protein : Integral membrane proteins are found in the bilayer membranes that…

Concept explainers

Osmosis

In simple words, osmosis is the slow, gradual movement of a liquid through a membrane. But there are nuances to this process. For instance, there has to be an imbalance in the distribution of solute in the liquid on either side of the membrane, which has to be semipermeable. The liquid in the region with a lower solute concentration moves to the region with a higher concentration, thereby displacing the solution in the process. The objective is to equalize the concentration of molecules on both sides of the membrane; the displacement of liquid can be viewed as a byproduct of this equalization. Since there is no energy required to carry osmosis, it is considered a passive process.

Question

1. Which membranes can proteins translocate across when they are being sorted/transported in a cell? Remember, there are three main ways proteins travel throughout a cell. This question is asking about translocation.

2. All transmembrane proteins have this sequence to allow them to get inserted into the membrane.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

25. Your friend works in a cell biology research lab. She is working she calls p125, because its molecular mass is 125 kiloDaltons. She knows that p125 is a transmembrane protein with three membrane-spanning domains. It has been previously reported that p125 interacts with three other proteins called p175, p80, and p50 (again, polyacrylamide gel). These four proteins in the cell. To determine how these proteins interact with the membrane, you perform a set of experiments in which you first lyse the cells and save some of your lysate, which you run in the input lane (labeled "I" in Figure Q25 below). The lysate is then subjected to a low-speed centrifugation so that you separate out the membrane fraction (which ends up in the pellet, "P") from the cytoplasm (which is in the supernatant, "S"). You then wash the pellet from the first extraction with a high-salt wash that does not disrupt the lipid bilayer, and save a little bit to run on the gel. After the high-salt wash, you centrifuge…
A scientist compares the plasma membrane composition of an animal from the Mediterranean coast with one from the Mojave Desert. Which hypothesis is most likely to be correct? The cells from the Mediterranean coast animal will have more fluid plasma membranes The cells from the Mojave Desert animal will have a higher cholesterol concentration in the plasma membranes The cells’ plasma membranes will be indistinguishable The cells from the Mediterranean coast animal will have a higher glycoprotein content, while the cells from the Mojave Desert animal will have a higher lipoprotein content.
3. Here is a question that test your ability to understand and combine concepts. hydropathy index I. II. III. IV. V. 50 100 amino acid number Shown on the left is a hydropathy plot of a plasma membrane integral protein lacking beta strand structures. It contains three domains A, B and C. Would you predict this protein to contain transmembrane helices? If so how many? If this protein is a Type-ll membrane protein, which region do you expect to be exposed to aqueous environment of the extracellular side (choose from A, B and C)? Why? Where do you expect to see positive charged residues? You can mention the rough residue numbers or use region, A, B or C to help convey your message. Explain your reasoning. Where do you expect to see aromatic residues? Explain your reasoning.
3. Consider a transmembrane protein that spans the inner nuclear membrane. Suggest a pathway by which such a protein could reach its destination. In your scheme, describe how the proposed mechanism would ensure that specific proteins are stably localized to the inner nuclear membrane whereas others are not.
1. You are working on identifying novel proteins associated with the plasma membrane and you isolate XYZ1. Protein sequencing shows XYZ1 is comprised of: MGASSCSELRSSAFALSERSDKSSAVLLIVLGVMAVGIYLLVTMVLIIGTSANRASGSKD SESMSTLECAAPNDSAA a. Based on the sequence. Do you predict this is a peripheral membrane protein or an integral membrane protein? (Hint: use the Hydropathy plot generator on Expasy using default settings to help answer this question.) b. You decide to conduct an experiment to further assess how the protein is connected to the PM. The experiment is conducted by either 1) treating intact cells with chymotrypsin, 2) by disrupting the plasma membrane such that chymotrypsin has access to both sides of the plasma membrane, or 3) by using detergents to remove all lipid bilayers and treating the proteins such that chymotrypsin will have access to -Chym. Cond. 1 - +Chym. Cond. 2 Cond. 3 the entire length of the protein. The treatments are run on an SDS-PAGE gel (together with an…
1. List four classes of membrane-associated proteins and briefly describe the differences between them. 2. What are 3 types of modifications that can anchor proteins to the membrane? How do they link to the proteins they anchor?
Part 2 of 3: Additionally, describe how the protein is being processed and where Protein: B-hexoaminidase Location: Lysosome
1. Integral and peripheral membrane proteins employ multiple strategies to keep them associated to a biological membrane. View these three proteins below, and for each protein shown, answer the following questions: A) What type of membrane protein is this? Integral, peripheral, monotopic, polytopic? How do you know? Justify your label by features of the protein shown in the image. B) Describe the overall tertiary structure of each protein. Be certain to mention hydrophilicity/hydrophobicity of the surfaces of this protein. C) Provide a detailed description of how each protein is held associated to the biological membrane. Protein 2 Protein 3 Protein 1 "H,N. Exterior Cytosol
3. Some proteins are membrane bound and have segments (called transmembrane domains) that pass through the membrane and anchor the protein to the lipid bilayer. Predict which amino acid residues are likely found in the transmembrane domains of proteins, and which amino acid residues are likely found just at the membrane surface on the interior and exterior of the cell. Succinctly explain your rationale.
2. "My Life As a Protein" Write a short story about your life as a chemical message/protein that was created by the nucleus. i. ii. iii. iv. Describe your journey through the cell after the nucleus has given the instructions to have you made. Describe how each of the organelles affects your journey as you travel through the cell and ultimately, through the cell membrane. Organelles you should mention include the nucleus, nuclear membrane, nucleolus, ribosomes, endoplasmic reticulum, cytoplasm, Golgi body, and plasma/cell membrane. Be creative and describe as many organelles as you can.
1. Explain in detail how amino acids can be transported across the plasma membrane 2. By using the concept of endomembrane system, explain how plasma membrane involves in the protein synthesis of a cell. 3. With suitable examples, compare the structural and functional differences between a fibrous and globular protein. 4. A person suffers from a skin condition and loss of muscle. A doctor suspects the patient has protein deficiency. Justify why the doctor thinks so.
11. Treatment of disrupted erythrocyte membranes with a concentrated salt solution released an unknown membrane protein, X. Proteolytic enzymes cleaved X into fragments. In additional experiments, intact erythrocytes were treated with proteolytic enzymes, washed, then disrupted. Extraction of membrane components yielded intact X. What do these observations indicate about the location of X in the plasma membrane? Do the properties of X resemble those of an integral membrane protein or a peripheral membrane protein?