) Base pairs Ladder S1 250 100 80 60 50 40 30 25 20 15 10 7 5 2 52 Crime scene S2 52 Base pairs Ladder S1 250 100 ) 80 60 50 40 30 25 20 15 10 22227 5 2 Crime scene
Q: Use the drop-down menus to determine where these organelles can be found. Ribosome…
A: Lists each organelle, its location (which type of cells it is found in), and its…
Q: Please read the two abstract and make three bullet points identifying three issues withthe abstract…
A: The Chat GPT abstract suggests that the study by Shevlin and Miggin is primarily focused on the…
Q: 1.) What process is shown here?2.) Label the structures- components that the arrows are pointing to…
A: The diagram illustrates an mRNA bound to the ribosome. The tRNA molecules, each carrying specific…
Q: Following the brief descriptive style we employed in class for Vitamin B12-utilizing enzymes,…
A: Step 1: Step 2: Step 3: Step 4:
Q: Taq polymerase advantage and disadvantages over other polymerase
A: Taq polymerase is a thermostable DNA polymerase named after the thermophilic bacterium Thermus…
Q: How may the abuse of drugs relate to the plasticity of the brain?
A: Brain plasticity, also known as neuroplasticity, refers to the brain's ability to change and adapt…
Q: Nernst: Ex =RT In [X]。 [X] Goldman: Em =RT In PNa [Na]o+ Pk+[K+]o + Pai-[CI-]i PNa [Na]+Pk+ [K] +…
A:
Q: Answer in step by step with explanation. Don't use Ai and chatgpt. Answer in all options
A: Important information:Resting membrane potential is established by the separation of charges across…
Q: Which of the following most likely explains an elevated heart rate? A) Increased leakiness of SA…
A: A) Increased leakiness of SA node's sodium and potassium channels:Electrical impulses that control…
Q: Which order doesn't belong to mammalian: monotremata, lagomata, Insectivora, sohenondon or edentata
A: The question is asking us to identify which of the given orders does not belong to the class…
Q: Please help answer
A: 1) C) Fluorescence microscope Fluorescence microscopy is particularly well-suited for viewing…
Q: Hello, Can you please help me with the next question? (I would apreciate a short answer). Based on…
A: It is obvious! You would use phrases that describe the morphology of a bacteria in order to classify…
Q: Abscission Zone: The Abscission Zone forms at the It facilitates leaves to The Abscission Zone is…
A: Your inquiries include a wide range of subjects, such as the anatomy and physiology of plants as…
Q: The following questions are grade 12 biology questions. Answer the multiple choice questions shown…
A: Refer to the solution
Q: What is staphylococcal enterotoxin B? Where is the agent staphylococcal enterotoxin B geolocation…
A: Staphylococcal enterotoxin B (SEB) is a type of exotoxin produced by the Staphylococcus aureus…
Q: In some plants, a purple pigment is synthesized from a colorless precursor. In a cross between two…
A: The question is asking us to determine the mode of inheritance and the phenotypic ratio based on the…
Q: None
A: Approach to solving the question: Detailed explanation: Examples: Key references: Biology…
Q: Describe two properties of neurons. Compare the NMJ with the normal synapse including two…
A: references:https://www.ncbi.nlm.nih.gov/books/NBK26910/https://www.ncbi.nlm.nih.gov/books/NBK546639/…
Q: Describe the wild type phenotype in fruit flies and list the 5 phenotypes that are different from…
A: In genetics, the term wild type refers to the phenotype of the typical form of a species as it…
Q: could you help me explain the steps to solving this problem?
A: To solve this problem and create a restriction enzyme map based on partial BamHI digests, follow…
Q: Which show radial symmetry annelids, vertebrates,echinoderms, none or all?
A: In biology, symmetry refers to the balance in proportions of the body and its parts. Radial symmetry…
Q: Hello, Can you help me to describe the characteristics of Antimicrobial Agents? Characteristics of…
A: Let's break down each of the characteristics of an ideal antimicrobial agent, with a detailed…
Q: 1. Draw a cell that is 2n=8 and is in prophase 1 of meiosis. Draw all of the daughter cells at the…
A: Conclusion Nondisjunction during meiosis can result in the unequal distribution of chromosomes…
Q: In the KS05 profile, "The greatest amount of salt occurs at the surface, and in the underlying Btkz…
A: The process responsible for high salt concentrations at the surface is capillary action and…
Q: Hello, Can you please help me with the next question? How does the rabies virus enter the body and…
A: Rabies is primarily transmitted through the bites of infected animals, including dogs and bats. The…
Q: Eight mutant strains of flowers were found to have white petals. Normal flowers are pink. The flower…
A: Detailed explanation:In this complementation test, eight different mutant strains of flowers, each…
Q: What is the purpose of ribozymes in microbial cells which differ from enzymes?
A: Ribozymes are RNA molecules that have the ability to catalyze specific biochemical reactions,…
Q: what is the correct description for the image. this is a practice problem
A: Approach to solving the question: Detailed explanation:Atrial flutter. Multiple waves appear between…
Q: What is the difference between a fibrous, cartilaginous, and a synovial joint? How are the two…
A: Approach to solving the question: Detailed explanation: Examples: Key references:
Q: Question: The postdoc in the lab gives you two samples: one is the Gram-positive B. anthracis and…
A: Approach to solving the question: Detailed explanation:When comparing the Gram-positive…
Q: Nine out of 10 adults in the United States do not have proficient health literacy and therefore are…
A: The statement, "Nine out of ten adults in the United States do not have proficient health literacy…
Q: consider a muscle cell is changing from relaxation to contraction 1)Is the length of the…
A: Understanding SarcomeresStructure of SarcomeresSarcomeres are the smallest functional units of…
Q: Below is another image of dividing onion root cells undergoing mitosis. In what phase of mitosis is…
A: Mitosis is the process by which a eukaryotic cell divides its nucleus and separates its chromosomes…
Q: Pick one of the three sections marked in the graph (A, B, or C) and explain why you see the trend…
A: Before we can explain the trend in any of the sections, we first need to understand what the graph…
Q: Bees do not eat pollen. They only inadvertently transport pollen to pollinate angiosperms. True or…
A: Bees play a critical role in both pollination and their own survival through their interaction with…
Q: Which of the following scientific investigations may use a compound light microscope? (check all…
A: A compound light microscope is a type of microscope that uses light and lenses to magnify images. It…
Q: What is the difference between apoptosis and necrosis? Name and describe one way to hold cells…
A: Approach to solving the question:Researched through Books and online resources/ reference with…
Q: 3. A population has a nucleotide diversity (p) of 0.08 and a neutral mutation rate of 5' 10" per…
A: Part a: Effective Population Size Calculation and InterpretationThe effective population size (Ne)…
Q: Describe three mechanisms of how adrenergic stimulation of nodal cells and/or cardiocytes increases…
A: Adrenergic stimulation plays a crucial role in regulating heart rate (chronotropy) and contraction…
Q: A woman, seeking genetic counseling, is found to be heterozygous for a chromosomal rearrangement…
A: Detailed explanation:B. Demonstrating chromosomal pairing during meiosis:In meiosis, homologous…
Q: Make a claim or observation about dead zones and nitrogen input in the Chesapeake Bay that is…
A: Approach to solving the question:The correlation between dead zones and nitrogen input in Chesapeake…
Q: Charlotte Auerbach (1899-1994), who was a pioneering German-born geneticist who made significant…
A: Approach to solving the question: To effectively answer the question regarding Charlotte Auerbach's…
Q: Answer in step by step with explanation. Don't use Ai and chatgpt.
A: Step 1:
Q: What type of intercellular communication do cardiac muscle cells use to transmit electrical signals?…
A: Cardiac muscle cells (cardiomyocytes) use gap junctions for intercellular communication to transmit…
Q: Use the diagram below to answer the questions. hematocrits normal plasma leukocytes erythrocytes…
A: 1. Cancer of the white blood cells is called leukemia. Like other cancers, leukemia is associated…
Q: 1. A) Suppose that you crossed purple corn vs yellow corn and you got an F2 generation consisting of…
A: 1. HypothesesNull Hypothesis (H₀): The observed distribution of purple and yellow kernels follows…
Q: The Delta variant of SARS-CoV-2 was first discovered in India in October of November 2020. By the…
A: Part 1: Calculate the Maximum Number of GenerationsWe are given the following information:The virus…
Q: Please draw them and folllow direction A) describe what you see, and (b) give examples of locations…
A: A) picture of each epithelial tissue:1) Simple squamous epithelium:2) Simple cuboidal epithelium:3)…
Q: Genes on the X-chromosome mostly have nothing to do with biological sex determination. How many…
A: The X chromosome is one of the two sex chromosomes in humans (the other is the Y chromosome). It is…
Q: Consider the peptide Lys-Ser-Glu-Cys-His-Tyr. For the drawings requested below,please show in…
A:
How do you think the DNA gel would look if those fragments were separated by gel electrophoresis? Select one of the provided pictures that fits best what you would expect to see.
Step by step
Solved in 2 steps
- 6. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…t (5 a 1 dao) - Google Chrome edu.om/mod/quiz/attempt.php?attempt=2334320&cmid=1127808 SQU E-LEARNING SYSTEM (ACAI الوقت المتبقي 0.175mm .e O In the DNA extraction experiment, the separation of DNA from its packaging protein can be achieved by the addition of Detergent aO 1.00 Salt b O هذا السؤال Ethyl alcohol cO Papain powder .d O Cold water Le O In paramecium, osmoregulation occurs through 3 Activate Windowssk Macronucleus Goaotings to acttivate do nere to search 6. 70°F Mostly sunny 9:05 ENG 12/18 f2 O f3 O f4 O f6 O f8 end f7 0 F10 insert f9 D F12 T num IA break @ %24 & 8 2 3 r 4 5 6 7 8 A 9 9 R Y ! U S F G J K +|| 回 Q 以 461 identify the primer 3' 5' a 5' 3' C e f a 5' 3' 3' 5' Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. a a b b e f a Save Unanswered
- Can I have some help with this please ,I just need to know what to match with what for this slide , thank you!Aa Po AaBbCcDc AaBbCcDdEe AaBbCcDdE AaBbCcDdE AaBbCcDdE BIUVab x, x A ev A 三==|這、|の Caption Emphasis Heading 1 Heading 3 Heading 4 Style Pane (a) Complete the table, using a letter D, R or B, to show whether each statement applies to: Fo DNA only (D) TA2G – Completed forms must be available for Open Awards external moderation purposes. Page 6 of 15 > T | RNA only (R) Both DNA and RNA (B) Statement D or R or B Contains thymine Contains ribose Consists of two chains connected to each other with hydrogen bonds Has a sugar-phosphate backbone Has four different nitrogenous bases Contains a pentose sugar Is found in the nucleus and cytoplasm English (United Kingdom) Focus 目民 2490 words +1Design Layout References Mailings words ● ● Endocrine System Part 2 Lecture-OBJECTIVES FOR PRE-LECTURE QUIZ #2 ● 1. Recognize the following types of biomolecules when given images such as the ones below and on the next page: ● glucose (which is a monosaccharide) ● triglycerides ● Review phospholipids DNA ● RNA view • X English (United States) Add Pen OFF Draw with Trackpad polysaccharide amino acid protein (recall a protein with less than 50 amino acids can also be called a peptide whereas a protein with 50 or more amino acids can also called a polypeptide) steroids DNA MacBook Air I Focus Page 2 of 10 ER
- What does BLAST stand for? O Basic Local Alignment Search Tool O Basic Local Alignment SequenceTool O Best Local Alignment Search Tool O Best Local Algorithm Search Toolme Insert Design at Painter 278 words Calibri Layout 11.5A A Aa BIU-abe X₂ X² A--A- ype here to search Font W Unique Unigriffin DNA: mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: References # M 3 How DNA Determines Traits- Transcription and Translation Fill in easier type.pptx part 2 - Word Tell me what you want to do... Mailings Review View A-6-5- LLI Paragraph | CAG TCG TTT | ATG GGG CTT CTT TIT | GAG AAT TCA CGC I S4 | CGA CAA CAC | GTA GTA | CAA AAA ATG | TTA TAG AAT GAC GGG TGG | wwwwww O 2 A W R =-- | TTA TTG TTA CGG | AAA AGA CCT | GCA GCC TTG TGT | de in ACROBAT % 5 ¶ T 1 Normal AaBbCcDc AaBbCcl AaBbCcL AaBbCcDc AaBbCcDc AaBbCc[ AaBbCcD Aal 1 Body Text 1 List Para... 1 No Spac... 1 Table Par... Heading 1 1 Heading 2 Hea Styles Y 7 OM O 38°F JACQUI 10 LANSWER MUST BE TYPED ANSWER WITH (900-1000 WORDS FOR OVERALL ANSWER)
- How is the DNA used for catching crime suspects. Describe the procedure and cite particular example where it helped solve a case or absolved an innocent person from any wrongdoingDraw the Haworth projection of B-L-altrose. You will find helpful information in the ALEKS Data resource. Explanation 2 Check # 3 Click and drag to start drawing a structure. $ 4 % 5 80 6 :: & 7 X S * 00 to v © 2023 McGraw Hill LLC. All Rights Reserved. Terr ( 9Download BLOSUM30 and BLOSUMB0 substitu- tion matrices and place them side by side on your computer screen. What are the differences between the two matrices? Why do you see these differences?
