1. You are working on identifying novel proteins associated with the plasma membrane and you isolate XYZ1. Protein sequencing shows XYZ1 is comprised of: MGASSCSELRSSAFALSERSDKSSAVLLIVLGVMAVGIYLLVTMVLIIGTSANRASGSKD SESMSTLECAAPNDSAA a. Based on the sequence. Do you predict this is a peripheral membrane protein or an integral membrane protein? (Hint: use the Hydropathy plot generator on Expasy using default settings to help answer this question.) b. You decide to conduct an experiment to further assess how the protein is connected to the PM. The experiment is conducted by either 1) treating intact cells with chymotrypsin, 2) by disrupting the plasma membrane such that chymotrypsin has access to both sides of the plasma membrane, or 3) by using detergents to remove all lipid bilayers and treating the proteins such that chymotrypsin will have access to -Chym. Cond. 1 +Chym. Cond. 2 Cond. 3 the entire length of the protein. The treatments are run on an SDS-PAGE gel (together with an untreated control) and immunoblotted using anti-XYZ1 antibodies. i. What amino acid residues does chymotrypsin proteolytically cleave after? ii. Is the protein peripheral/integral? How do you know? What would the results have looked like if it were the opposite result? iii. Digestion at Y-39 (right in the middle of the XYZ1) does not happen until condition 3. Based on your answer in (ii) what might be preventing digestion at this site? iv. You conduct a proteomics study and find that XYZ1 is palmitoylated on Cys-69. How might you further explore the importance of this modification on XYZ1 function?

Human Anatomy & Physiology (11th Edition)
11th Edition
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:Elaine N. Marieb, Katja N. Hoehn
Chapter1: The Human Body: An Orientation
Section: Chapter Questions
Problem 1RQ: The correct sequence of levels forming the structural hierarchy is A. (a) organ, organ system,...
icon
Related questions
Question
1. You are working on identifying novel proteins associated with the plasma membrane
and you isolate XYZ1.
Protein sequencing shows XYZ1 is comprised of:
MGASSCSELRSSAFALSERSDKSSAVLLIVLGVMAVGIYLLVTMVLIIGTSANRASGSKD
SESMSTLECAAPNDSAA
a. Based on the sequence. Do you predict this is a peripheral membrane
protein or an integral membrane protein? (Hint: use the Hydropathy plot
generator on Expasy using default settings to help answer this question.)
b. You decide to conduct an experiment
to further assess how the protein is
connected to the PM. The experiment
is conducted by either 1) treating
intact cells with chymotrypsin, 2) by
disrupting the plasma membrane such
that chymotrypsin has access to both
sides of the plasma membrane, or 3)
by using detergents to remove all lipid
bilayers and treating the proteins such
that chymotrypsin will have access to
-Chym. Cond. 1
-
+Chym.
Cond. 2 Cond. 3
the entire length of the protein. The treatments are run on an SDS-PAGE gel
(together with an untreated control) and immunoblotted using anti-XYZ1
antibodies.
i. What amino acid residues does chymotrypsin proteolytically cleave
after?
ii. Is the protein peripheral/integral? How do you know? What would the
results have looked like if it were the opposite result?
iii. Digestion at Y-39 (right in the middle of the XYZ1) does not happen
until condition 3. Based on your answer in (ii) what might be
preventing digestion at this site?
iv. You conduct a proteomics study and find that XYZ1 is palmitoylated on
Cys-69. How might you further explore the importance of this
modification on XYZ1 function?
Transcribed Image Text:1. You are working on identifying novel proteins associated with the plasma membrane and you isolate XYZ1. Protein sequencing shows XYZ1 is comprised of: MGASSCSELRSSAFALSERSDKSSAVLLIVLGVMAVGIYLLVTMVLIIGTSANRASGSKD SESMSTLECAAPNDSAA a. Based on the sequence. Do you predict this is a peripheral membrane protein or an integral membrane protein? (Hint: use the Hydropathy plot generator on Expasy using default settings to help answer this question.) b. You decide to conduct an experiment to further assess how the protein is connected to the PM. The experiment is conducted by either 1) treating intact cells with chymotrypsin, 2) by disrupting the plasma membrane such that chymotrypsin has access to both sides of the plasma membrane, or 3) by using detergents to remove all lipid bilayers and treating the proteins such that chymotrypsin will have access to -Chym. Cond. 1 - +Chym. Cond. 2 Cond. 3 the entire length of the protein. The treatments are run on an SDS-PAGE gel (together with an untreated control) and immunoblotted using anti-XYZ1 antibodies. i. What amino acid residues does chymotrypsin proteolytically cleave after? ii. Is the protein peripheral/integral? How do you know? What would the results have looked like if it were the opposite result? iii. Digestion at Y-39 (right in the middle of the XYZ1) does not happen until condition 3. Based on your answer in (ii) what might be preventing digestion at this site? iv. You conduct a proteomics study and find that XYZ1 is palmitoylated on Cys-69. How might you further explore the importance of this modification on XYZ1 function?
Expert Solution
trending now

Trending now

This is a popular solution!

steps

Step by step

Solved in 3 steps

Blurred answer
Knowledge Booster
Membrane chemistry
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.
Similar questions
  • SEE MORE QUESTIONS
Recommended textbooks for you
Human Anatomy & Physiology (11th Edition)
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:
9780134580999
Author:
Elaine N. Marieb, Katja N. Hoehn
Publisher:
PEARSON
Biology 2e
Biology 2e
Biology
ISBN:
9781947172517
Author:
Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:
OpenStax
Anatomy & Physiology
Anatomy & Physiology
Biology
ISBN:
9781259398629
Author:
McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:
Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:
9780815344322
Author:
Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:
W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:
9781260159363
Author:
Martin, Terry R., Prentice-craver, Cynthia
Publisher:
McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Inquiry Into Life (16th Edition)
Biology
ISBN:
9781260231700
Author:
Sylvia S. Mader, Michael Windelspecht
Publisher:
McGraw Hill Education