Pearson eText Biology: Life on Earth with Physiology -- Instant Access (Pearson+)
12th Edition
ISBN: 9780135755785
Author: Gerald Audesirk, Teresa Audesirk
Publisher: PEARSON+
expand_more
expand_more
format_list_bulleted
Question
Chapter 2.3, Problem 3TC
Summary Introduction
To determine:
Based on the configurations explain the reason for the floating of ice.
Concept introduction:
The molecules present in water forms hydrogen bonding with each other. This hydrogen bonding becomes stronger when water is converted into ice. The ice is formed by the bonding (stronger) and behaves like a crystal. This is seen in ponds in winters when the ice floats over the water.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
Why does ice float in water?
6-73 In each case, tell which side (if either) rises and why.
The solvent is water.
A
A
Osmotic
membrane
(a) 1% glucose
(b) 0.1 M glucose
(c) 1 M NaCl
(d) 1 M NaCl
(e) 3% NaCl
(f) 1 M NaBr
(B)
B
5% glucose
0.5 M glucose
1 M glucose
1 M K₂SO4
3% KC1
1 M KC1
What is the molarity of a solution if 360 g of glucose (C6H1206) is dissolved in 500 mL of solution?
O 0.72 M
O 4 M
O 1.02 M
2М
Chapter 2 Solutions
Pearson eText Biology: Life on Earth with Physiology -- Instant Access (Pearson+)
Ch. 2.1 - What is the mass number of hydrogen? Of helium?Ch. 2.1 - Unstable Atoms Unleashed Because exposure to...Ch. 2.1 - Prob. 2TCCh. 2.1 - What causes the coals of a campfire to glow?Ch. 2.1 - In addition to lower brain activity, what other...Ch. 2.1 - define clement and atom?Ch. 2.1 - Prob. 2CYLCh. 2.1 - explain atomic number and mass number?Ch. 2.1 - explain radioactivity and its dangers and...Ch. 2.1 - describe electron shells?
Ch. 2.2 - At a physical exam, Thomas, a sedentary...Ch. 2.2 - Prob. 1CYLCh. 2.2 - Prob. 2CYLCh. 2.2 - explain atomic number and mass number?Ch. 2.3 - The slap of a belly flop provides firsthand...Ch. 2.3 - Prob. 1TCCh. 2.3 - Predict how a drop of water on an oil-coated...Ch. 2.3 - Prob. 3TCCh. 2.3 - Prob. 1CYLCh. 2.3 - Prob. 2CYLCh. 2.3 - explain atomic number and mass number?Ch. 2.3 - Prob. 1CTCh. 2 - Which of the following is false? a. An dement is...Ch. 2 - Prob. 2MCCh. 2 - Isotopes are defined as a. atoms of the same...Ch. 2 - Prob. 4MCCh. 2 - Prob. 5MCCh. 2 - An atom consists of an atomic nucleus composed of...Ch. 2 - An atom that has lost or gained one or more...Ch. 2 - Prob. 3FIBCh. 2 - Prob. 4FIBCh. 2 - Water is described as __________ because each...Ch. 2 - Prob. 1RQCh. 2 - Distinguish between atoms and molecules and among...Ch. 2 - Prob. 3RQCh. 2 - Prob. 4RQCh. 2 - Prob. 5RQCh. 2 - Prob. 6RQCh. 2 - Prob. 7RQCh. 2 - Detergents help clean by dispersing fats and oils...Ch. 2 - Prob. 2ACCh. 2 - Prob. 3AC
Knowledge Booster
Similar questions
- Figure 2.12 A pH scale. Here, red dots signify hydrogen ions (H+) and blue dots signify hydroxyl ions (OH). Also shown are the approximate pH values for some common solutions. This pH scale ranges from 0 (most acidic) to 14 (most basic). A change of one unit on the scale corresponds to a tenfold change in the amount of H+ ions. Photos, JupiterImages Corporation. Figure It Out: What is the approximate pH of cola?arrow_forward1. A recent preprint article e reported pre-clinical evaluations of an inactivated Newcastle disease virus (NDV) chimera stably expressing the membrane-anchored form of the SARS-CoV-2 spike region (NDV-S) as a potent COVID-19 vaccine in mice and hamsters. To design the SF Chimera, researchers combined the transmembrane domain and cytoplasmic tail of NDV F protein with the ectodomain of the SARS-CoV-2 S region, whose sequence is as follows: MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAS TEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKH TPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV…arrow_forward4 Which of the following graphs, A or B, illustrates the typical behavior of a solid dissolving in water? Explain your choice. A 100 90 B 100 Solubility (g solute in 100 mL H₂O) 80 70 60 50 40 30 20 10 0 0 10 KCI Solubility (g solute in 100 mL H2O) 90 80 70 60 50 Na₂SO4 40 30 20 10 0 20 20 30 40 50 60 70 80 90 100 0 10 20 30 40 50 60 70 Temperature (°C) Temperature (°C) 5 Why is it important to measure the masses of the NaCl and KNO, samples in Part B? - 80 90 100arrow_forward
- Why does water only have a density of 4?arrow_forward8arrow_forwardA solution has a hydrogen ion concentration of 0.01 mol/L. What is its pH? What is its hydroxide ion concentration? Is it acidic, basic, or neutral? How does the hydrogen ion concentration of this solution differ from one with a pH of 1?arrow_forward
- Hi there! I really neeed some help. I cannot figure this problem out! Thank you! If you pour whisky over ice, the ice will cool the drink, but it will also dilute it. A solution is to use whisky stones. Suppose Ernest pours 55.0 g of whisky at 25 ∘C room temperature, and then adds three whisky stones to cool it. Each stone is a 32.0 g soapstone cube that is stored in the freezer at -19 ∘C. The specific heat of soapstone is 980 J/kg * K; the specific heat of whisky is 3400 J/kg⋅Karrow_forwardнннн ннннН с-С-с-с-с-С-С-С-С-с-н HHHH HHHH H H. Ising the graphic above, answer the following question. orrectly identify the above molecule. s this molecule solid or liquid at room temperature? Name a major source of this macromolecule.arrow_forwardAt pH=2.2, which of the following is true COOH Ç00 COO ÇO0 H3N-CH H,N-CH H,N-CH H2N-CH CH2 CH2 CH CH2 pK1 CH2 pKr CH2 pK, CH2 CH COOH СООН CO COO 1. II IV O50 % of carboxylic acid group in the side chain is ionized O Most of the molecules are in the form II C None 50% of carboxylic acid group attached to alpha carbon is ionized 50% of amino group is ionizedarrow_forward
- 4arrow_forwardCalculate the ratio [CH3COOH]/[N2CH3COO] that gives a solution with pH = 5.00? * 0.28 0.36 0.44 0.56 0.63arrow_forwardThe water lattice: a. is formed from hydrophobic bonds. b. causes ice to be denser than water. c. causes water to have a relatively low specific heat. d. excludes nonpolar substances. e. is held together by hydrogen bonds that are permanent; that is, they never break and reform.arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage Learning
Biology: The Unity and Diversity of Life (MindTap...BiologyISBN:9781337408332Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa StarrPublisher:Cengage Learning
Biology: The Dynamic Science (MindTap Course List)BiologyISBN:9781305389892Author:Peter J. Russell, Paul E. Hertz, Beverly McMillanPublisher:Cengage Learning
Anatomy & PhysiologyBiologyISBN:9781938168130Author:Kelly A. Young, James A. Wise, Peter DeSaix, Dean H. Kruse, Brandon Poe, Eddie Johnson, Jody E. Johnson, Oksana Korol, J. Gordon Betts, Mark WomblePublisher:OpenStax College
Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
Biology: The Unity and Diversity of Life (MindTap...
Biology
ISBN:9781337408332
Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr
Publisher:Cengage Learning
Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning
Anatomy & Physiology
Biology
ISBN:9781938168130
Author:Kelly A. Young, James A. Wise, Peter DeSaix, Dean H. Kruse, Brandon Poe, Eddie Johnson, Jody E. Johnson, Oksana Korol, J. Gordon Betts, Mark Womble
Publisher:OpenStax College
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax