Trypsin is active in Acidic Alkaline Nutral All of above the term apoenzyme is applicable to simple enzyme protein part of conjugate enzyme organic cofactor of conjugate enzym inorganic cofactor of cinjugate enzyme

Trypsin is active in Acidic Alkaline Nutral All of above the term apoenzyme is applicable to simple enzyme protein part of conjugate enzyme organic cofactor of conjugate enzym inorganic cofactor of cinjugate enzyme

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Related questions

Q: Which of the following amino acid cannot bind a heme group using its side chain as an axial ligand?…

Q: tein code shown. On the basis of the enzyme’s structure, its substrate and mechanism of action,…

A: The selective hexokinase 2 inhibitor is Benserazide. It can be typically binds to hexokinase 2 and…

Q: Two curves showing the rate versus substrate concentration are shown below for an enzymecatalyzed…

A: Correct option : B) X is an activator of the enzyme.Allosteric activator of the enzyme decrease the…

Q: The side chain of cysteine is weakly acidic. Suppose in a protein, the side chain of a cysteine…

Q: a.) c.) H₂N H₂N OH -OH OH _OH b.) d.) H₂N H₂N ОН OH OH

A: The question is based on the concept of amino acids. We need to identify the amino acid which…

Q: Plot the enzyme activity (absorbance) versus pH. From this curve, what is the optimal pH? Explain…

A: Enzymes are catalysts that increase the rate of chemical reactions taking place in living organisms…

Q: Select below all the catalytic mechanisms used by chymotrypsin to convert substrate into product.

A: Chymotrypsin is a digestive enzyme belonging to a superfamily of enzymes called serine proteases. It…

Q: The catalytic activity of an enzyme is being measured at pH 7.5 and requires that the side chain of…

A: The enzymes worked as a catalyst in the biological reaction. These can be present in the active or…

Q: Why is there a thermodynamic push toward enzyme-substrate complex formation when a nonpolar…

A: Interpretation - To tell about why there is a thermodynamic push toward enzyme-substrate complex…

Q: . Delineate the detailed regulatory mechanism of activation of protein kinase A (PKA)…

A: Answer - According to the question - Protein kinase A (PKA) is activated by elevations in cAMP and…

Q: Chemistry 3. The molecules below both inhibit proline racemase. Explain why these molecules would be…

A: The racemization of proline is facilitated by the enzyme, proline racemase and the racemization of…

Q: In carbonic anhydrase II, Zn* acts as a Lewis acid coordinated in the enzyme active site to…

A: This statement is False. carbonic anhydrase is an enzyme used to increase the rate of equilibrium…

Q: Covalent enzyme catalysis involves the formation of a transient covalent bönd between an enzyme and…

A: Amino acids are the biomolecules that have amino as well as carboxylic acid group bonded to alpha…

Q: As you increase the temperature of an enzyme-catalyzedreaction, the rate of the reaction initially…

Q: Which of the following enzyme functional groups is in a form in which it could serve as a general…

A: Acids are substance which can give proton/Hydrogen ion. Strong acid give stable conjugate base.…

Q: Calculate the specificity constant for an enzyme-catalyzed reaction if the total enzyme…

A: Given Etotal = 15 nMVmax = 9 M/sKm = 150 MSpecificity constant = to be determined

Q: RNase is an enzyme that cleaves the P-O bond in RNA. It has two His residues in the active site.…

A: In the catalysis by RNase, two histidine are considered as critical residues.There is a classic…

Q: Oxaloacetate is an inhibitor of succinate dehydrogenase because it is structurally very similar to…

Q: An enzyme catalyzes the hydrolysis of an ester with a certain activity, but this activity is lost in…

A: Any enzyme can be categorised a certain protein which loses its activity at a certain temperature,…

Q: Summarize three ways in which an enzyme might lower the energy of a activation of a raction 2. What…

A: PART A - The three ways in which an enzyme might lower the energy of a activation of a reaction are…

Q: H2 + CH2 = CH2 --> CH3CH3 Which of the following could be a substrate for an enzyme that has an…

A: Option D is Correct Answer.

Q: Enzyme kinetics a. How to determine Km and Vmax of a-glucosidase enzyme isolated from weathered rice

Q: 1. Calculation of AG from an Equilibrium Constant Calculate the standard free-energy change for each…

Q: 1. Fill In the blank with the correct terms. Term for elemental cations that act as enzymatic…

A: Enzymes are proteins that allow reactions within the body to occur faster and with less energy. By…

Q: 3. Some medications permanently inactivate their target enzyme by forming a covalent bond to an…

A: Given, drug is penicillin. The structure of penicillin is shown below: The active site in…

Q: given a solution of alanine at pH 9.00, draw the structure of the species present in appreciable…

A: The given amino acid is alanine. pH of the given alanine solution = 9.00The Henderson-Hasselbalch…

Q: The thiamine pyrophosphate (TPP)-dependent enzyme benzoylformate decarboxylase catalyzes the…

A: Thiamine pyrophosphate (TPP) is a coenzyme useful for the cleavage of carbon-carbon bond. The C-2…

Q: Net charge and isoelectric point of an amino acid with an ionizable side group.Consider the net…

A: Hey since you have posted a question with multiple sub-parts, we will solve first three sub-parts…

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this region.…

A: There are two secondary structures: 1. Alpha Helix 2. Beta sheets RRPVVLMAACLRPVVFITYGDGGTYYHWYH…

Q: 2. The following mechanism has been proposed for superoxide dismutase. active site H*. H2O2 (ii) H20…

Q: Chorismate mutase is an enzyme that promotes a pericyclic reaction by forcing the substrate to…

A: Chorismate mutase is an enzyme that promotes a pericyclic reaction by forcing the substrate to…

Q: Which of the statements about enzymes are true? Generally, an enzyme is specific for a particular…

A: Five statements regarding enzymes and their functions are given and we have ti identify whether…

Q: For an enzyme to catalyze a reaction, it must preferentially stabilize the transition state (TS) of…

A: A question based on enzyme catalysis reaction. A statement question about reaction coordinate in…

Q: Juan performed the same chemical reaction twice. His data from the first at- tempt is indicated by…

A: From the above diagram it is clear that overall energy released during the reaction for both…

Q: Polypeptides are polymers of amino acids. Suppose that a long polypeptide chain can undergo a…

A: There are generally three steps in step growth mechanism of the helical transformation, they are…

Q: Draw the structure of sialyl-Lewis X. What enzymes would you need to use to analyze its structure…

Q: What types of mechanisms occur in enzyme active sites? Identify the type(s) of mechanism shown…

A: In the first step of the reaction, there occurs the protonation of the epoxide O-atom. Then in the…

Q: Serine esterase contains a catalytic triad at its active site. Which amino acid in serine esterase…

Q: Protein A has a binding site for ligand X with a dissociation constant, Ka, of 3.0 × 10-' M. Protein…

A: We have to predict the protein that has great affinity for the ligand.

Q: There are almost 500 naturally occurring variants of hemoglobin. Hemoglobin X is a hemoglobin…

Q: Match the words in the left column to the appropriate blanks in The sentences on the right. Reset…

A: In the protein synthesis the inhibitors are the one which delays or stops the growth or…

Q: The substrate dissociation constant, Ks, is k.1/k1. What do large values of this constant mean? That…

Q: Select the energy diagram or diagrams that illustrate reactions in which the second step is rate…

A: Since you have asked multiple question, we will solve the first question for you. If you want any…

Concept explainers

Organic Chemistry of Metabolic Pathways

Metabolic pathways allude to the arrangement of chemical catalyzed reactions that lead to the transformation of a substance into the final product. Metabolic pathways incorporate a progression of reaction where the substrate is changed continuously and the transitional metabolites are persistently recovered.

Glucogenesis

Glucogenesis is a metabolic pathway in which glucose is produced from carbon substrates that are not carbohydrates. This process is observed in plants, animals, fungi, bacteria and other micro organisms. The general definition for glucogenesis or gluconeogenesis is as follows,

Question

Trypsin is active in
Acidic
Alkaline
Nutral
All of above
the term apoenzyme is applicable to
simple enzyme
protein part of conjugate enzyme
organic cofactor of conjugate
enzym
inorganic cofactor of cinjugate
enzyme

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps with 2 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

A peptide has the sequence Glu–His–Trp–Ser–Gly–Leu–Arg–Pro–Gly The p?a values for the peptide’s side chains, terminal amino groups, and carboxyl groups are provided in the table. Amino acid Amino pKa Carboxyl pKa Side‑chain pKa glutamate 9.609.60 2.342.34 4.254.25 histidine 9.179.17 1.821.82 6.006.00 tryptophan 9.399.39 2.382.38 serine 9.159.15 2.212.21 glycine 9.609.60 2.342.34 leucine 9.609.60 2.362.36 arginine 9.049.04 2.172.17 12.4812.48 proline 10.9610.96 1.991.99 Calculate the net charge of the molecule at pH 11 and estimate the isoelectric point (pI)(pI) for this peptide.
Provide an electron pushing mechanism for the conversion shown below. Abbreviate the enzyme catalyst active site groups (BH* and B:) as needed. Which purine base is used? NH₂ Enz H₂O 'N NH
The protein Westlin is 64% occupied when the concentration of its ligand, iocane, is 5 uM. Given this, the Kp of Westlin for iocane is uM. If the total concentration of Westlin is 2 nM, and the concentration of iocane is 10 uM, you know that the concentration of free protein must be nM.
In the Part II figure, showing the structure of the toxic South American rattlesnake peptide (see below), residue 4 interacts with residue 36 via a covalent bond. N Cys11 Cys36 Cys4 C Cys37 Cys18 2 Identify the nature of this bond and state whether it would be most likely to be found if the peptide is exposed to an oxidizing or a reducing environment.
One of the free energy (G)-reaction coordinate graphs given below belong to a ligand-binding protein, while the other two belong to two different enzymes. A)Which of the given graphs cannot belong to an enzyme? A, B or C Choose one of the options and explain your reasoning in one or two sentences. B)What does it mean if an enzyme has reached catalytic perfection? means? Which of the graphs of free energy change given above Could it belong to a catalytically perfect enzyme? C)what kinetic parameter/combination of parameters an enzyme shows its efficiency / whether it has reached catalytic perfection? D)Which step in the Michaelis-Menten mechanism is the rate of diffusion? limited to?
Examine this depiction of the initial steps of catalysis for a proteolytic enzyme. Oxyanion hole 93 with In 1-2 sentences, describe the role being played by the amino acid hydroxyl side chain in the step labeled 2. In 1-2 sentences, describe the role of the oxyanion hole. In 1-2 sentences, describe the role of the His is the step labeled 3.
Ni(II)-aminopyridine complex was synthesized using a metal-template condensation reaction presented below. Compound C is the target compound, but other Ni complexes can be produced as well as the intermediates of the reaction. H Н он H H2N H2N Ni(CIO,2 'N + HN N Ni2* HN 2 CIO, N N* HN 2 CIO, N N2* HN 2 CIO, H2O-ELOH reflux H2N. A B What spectral features would you expect to see in MS and IR to determine whether the synthesis was fully successful/complete?
Question 2. While internal cysteine amino acid sidechains in proteins undergo oxidation to produce disulfide crosslinks that stabilize the protein structure after folding, solvent-exposed cysteine sidechains can remain in their reduced thiol form and serve as reactive nucleophiles (recall for instance Acyl Carrier Proteins involved in fatty acid biosynthesis or various oxidoreductase enzymes). The reactive thiol groups in proteins can be detected using Ellman's test, wherein the protein is reacted with a disulfide Ellman's reagent to form a new mixed disulfide and a 2-nitro-5-thiobenzoate (TNB) byproduct. Upon addition of base, TNB is deprotonated to form a dianion, which absorbs light in the visible region and can be detected using UV-Vis spectroscopy. Ellman's Reagent CO₂H -NO₂ internal disulfide crosslink O₂N- HO₂C SH solvent- exposed thiol UV Absorbance at 412 nm O₂N- -S TNB²- alkaline pH O₂N- SH HO₂C 2-nitro-5-thiobenzoate (TNB) -NO2 mixed disulfide CO₂H a) Provide a detailed…
2. Based on their effects on enzyme kinetics, identify whether the type of enzyme inhibition by these drugs involves competitive, uncompetitive or noncompetitive inhibition Tamiflu Relenza
CHEMISTRY AND ENVIRONMENTAL POLLUTION Discuss why these organomercury compounds are more toxic and can bebioaccumulated as compare to its original Hg2+ ion.
Among these protein assays, which work in acidic conditions? a. Biuret assay b. Bicinchoninic acid assay c. Bradford assay d. Lowry assay
9. To what main enzyme class do the enzymes that catalyze the following reaction belong? (oxidoreductases, transferases, hydrolases, lyases, isomerases, ligases) HO H H₂N-C-CN-C-coo + H₂0- II HR₂ 1 R₁ This bond is cleaved H H₂N-C-Coo R₂ H₂N H 1 R₁ -COOⒸ