Trypsin is active in Acidic Alkaline Nutral All of above the term apoenzyme is applicable to simple enzyme protein part of conjugate enzyme organic cofactor of conjugate enzym inorganic cofactor of cinjugate enzyme

Trypsin is active in Acidic Alkaline Nutral All of above the term apoenzyme is applicable to simple enzyme protein part of conjugate enzyme organic cofactor of conjugate enzym inorganic cofactor of cinjugate enzyme

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Related questions

Q: QUESTION : Supposed you used the enzyme lyase in the biomolecular laboratory, identify reaction that…

Q: Assuming an excess of substrate, if the enzyme concentration is doubled in a reaction vessel, the…

A: Applying concept of enzyme catalysis.

Q: How many ATP equivalent would be consumed during the synthesis of an 150 amino acid residue protein.

Q: Two curves showing the rate versus substrate concentration are shown below for an enzymecatalyzed…

A: Correct option : B) X is an activator of the enzyme.Allosteric activator of the enzyme decrease the…

Q: a What would be the appropriate name for an enzyme that catalyzes each of the following reactions: b…

Q: Select below all the catalytic mechanisms used by chymotrypsin to convert substrate into product.

A: Chymotrypsin is a digestive enzyme belonging to a superfamily of enzymes called serine proteases. It…

Q: Provide a simple sketch of the covalent intermediate likely to form between active site serine…

A: Diphenylcarbamyl chloride aka diphenylcarbamoyl chlroide is a very toxic chemical, It is a very…

Q: о enzyme + O. о O NH3 Classify the enzyme based on its reaction O NH3 + Oxidoreductase Transferase…

A: The objective of this question is to classify which type of enzyme is used in a given…

Q: Which of the following reagents can be used to cleave a tert-butoxycarbonyl (Boc) protecting group…

A: Among the many amino protecting groups, one of the most important protecting group is…

Q: Alkaline phosphatase catalyzes the hydrolysis of various phosphate monoesters, including p-…

A: Para-Nitrophenylphosphate is a non-proteinaceous chromogenic substrate for alkaline and acid…

Q: О C) О H LOPO, OH CH,OPOyên NADH + Н +ADP + H NAD H HO 0 H +ATP OH CH,OPOS CH₂OH \CH,OPO (D) CHOH OH…

A: Enzymes are catalyst for biochemical reaction. Enzymes are necessesary for digestion and functioning…

Q: A 100% hydrocarbon side - chain would likely be a catalytic group at an enzyme active site. True or…

A: Enzymes are biological catalysts that speed up chemical reactions in living organisms. They are…

Q: What trend can you suggest for the stability of proteins under varying pH

A: As we decrease the pH (by adding acid ) converts COO- ion to a neutral COOH group. In each case the…

Q: What coenzymes or cofactors, amino acids, and structural features are present at the ligand or…

A: Myoglobin is a monomeric protein having molecular weight 17000 Dalton. It has a single polypeptide…

Q: A medicinal chemist is trying to determine the mechanism of action of inhibitors she has…

A: Since you have asked multiple questions, we will solve the first question for you. If you want any…

Q: Some proteases are cysteine proteases and threonine proteases as opposed to serine proteases. What…

A: Given proteases, Cysteine proteases Threonine proteases Serine…

Q: 4. What are the various modes of coordination of the imidazole ring in histidine and the carboxylate…

A: The coordination of amino acid residues to metal ions is a critical component of metalloproteins'…

Q: give the properties of the enzyme (e.g., shape, size, colour, price). a) aluminosilicate b) trypsin

A: In a chemical reaction, the compounds that help to increase the rate of a reaction are called…

Q: cch the hyd of the helic

A: The amino acids can be classified based on the polarity of the side chains to form a scale called…

Q: 5 (a) Describe in detail how you will determine the primary structure of protein. (c) You have been…

A: Amino acids are those hydrocarbons that have a central carbon atom which is attached to a carboxylic…

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this region.…

A: There are two secondary structures: 1. Alpha Helix 2. Beta sheets RRPVVLMAACLRPVVFITYGDGGTYYHWYH…

Q: Me HN Ме. NH NH2 N. N. IC50 31nM IC50 AG > 1.8 kcal mol-1 N. 12nM R R R s-cis s-trans СOMT СOMT H2N…

A: Structure 5 is more effective because it binds with COMT more strong than structure 4.In structure…

Q: ZI NH₂ N Enz H₂O N N NH

A: Tautomerism takes place initially to form immine which is readily attacked by H2O to form carbonyl…

Q: In the context of bioinorganic chemistry, consider a hypothetical enzyme that utilizes a metal ion…

A: Introduction:The phenomenon of an enzyme losing its activity under extremely high oxygen…

Q: Polypeptides are polymers of amino acids. Suppose that a long polypeptide chain can undergo a…

A: There are generally three steps in step growth mechanism of the helical transformation, they are…

Q: Draw the structure of sialyl-Lewis X. What enzymes would you need to use to analyze its structure…

Q: The enzyme that catalyzes the following reaction belongs to which class? is-ef O Lyase Isomerase…

A: Enzymes are bio catalysts which catalyse reactions in biological systems. They are highly specific…

Q: The following diagram illustrates the process of fragment-based drug discovery Binding site her…

A: In the development of drug, it is necessary that drug must be attached to binding site. Only a…

Q: Review the structure of the standard amino acids and listthose that are capable of acting as acids…

Q: (b) What do you mean by enzyme catalysis? Derive Michaelis-Menten's equation?

Q: A complex organic molecule that is necessary for enzyme function but is not permanently associated…

A: Enzymes are proteins that help speed up chemical reactions in our bodies. Note: According to…

Q: Serine esterase contains a catalytic triad at its active site. Which amino acid in serine esterase…

Q: Enzymes that display non Michaelis-Menton behavior: are multi subunit exists in relaxed (R) and…

A: Enzymes with more subunits do not follow the Michaelis Menton equation.

Q: Modification of the protein structure of a peroxidase enzyme is shown to increase the rate of…

A: Activation energy is defined as the energy difference between reactent molecule and transition…

Q: There are almost 500 naturally occurring variants of hemoglobin. Hemoglobin X is a hemoglobin…

Q: The substrate dissociation constant, Ks, is k.1/k1. What do large values of this constant mean? That…

Q: An enzyme that catalyzes the reaction of only one substrate is called Stereochemical specificity…

Concept explainers

Organic Chemistry of Metabolic Pathways

Metabolic pathways allude to the arrangement of chemical catalyzed reactions that lead to the transformation of a substance into the final product. Metabolic pathways incorporate a progression of reaction where the substrate is changed continuously and the transitional metabolites are persistently recovered.

Glucogenesis

Glucogenesis is a metabolic pathway in which glucose is produced from carbon substrates that are not carbohydrates. This process is observed in plants, animals, fungi, bacteria and other micro organisms. The general definition for glucogenesis or gluconeogenesis is as follows,

Question

Trypsin is active in
Acidic
Alkaline
Nutral
All of above
the term apoenzyme is applicable to
simple enzyme
protein part of conjugate enzyme
organic cofactor of conjugate
enzym
inorganic cofactor of cinjugate
enzyme

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps with 2 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

Select the energy diagram or diagrams that illustrate reactions in which the second step is rate determining. A Free Energy C Free Energy Reaction A Reaction B Reaction C Reaction D Reaction Coordinate B Reaction Coordinate Free Energy Reaction Energy Diagrams Reaction Coordinate D Free M=MM Energy Reaction Coordinate
The catalytic efficiency of many enzymes depends on pH. Chymotrypsinshows a maximum value of kcat/KM at pH 8. Detailed analysis shows thatkcat increases rapidly between pH 6 and 7 and remains constant at higherpH. KM also increases rapidly between pH 8 and 10. Suggest explanationsfor these observations.
Provide an electron pushing mechanism for the conversion shown below. Abbreviate the enzyme catalyst active site groups (BH* and B:) as needed. Which purine base is used? NH₂ Enz H₂O 'N NH
help please answer in text form with proper workings and explanation for each and every part and steps with concept and introduction no AI no copy paste remember answer must be in proper format with all working
In the Part II figure, showing the structure of the toxic South American rattlesnake peptide (see below), residue 4 interacts with residue 36 via a covalent bond. N Cys11 Cys36 Cys4 C Cys37 Cys18 2 Identify the nature of this bond and state whether it would be most likely to be found if the peptide is exposed to an oxidizing or a reducing environment.
Give a clear handwritten answer with each step explanation
Examine this depiction of the initial steps of catalysis for a proteolytic enzyme. Oxyanion hole 93 with In 1-2 sentences, describe the role being played by the amino acid hydroxyl side chain in the step labeled 2. In 1-2 sentences, describe the role of the oxyanion hole. In 1-2 sentences, describe the role of the His is the step labeled 3.
Question is in image.
help please answer in text form with proper workings and explanation for each and every part and steps with concept and introduction no AI no copy paste remember answer must be in proper format with all working
SOURCE: GENERAL, ORGANIC AND BIOLOGICAL CHEMISTRY BY Smith 4th Edition
Give me answer with explaination
What is the formula for ilum vaderide ImV2 ImV Im(1)V O Im2V