Independently synthesized and inherited pigments (a) (b) (c) (d) FIGURE 6-14 In corn snakes, combinations of orange and black pigments determine the four phenotypes shown. (a) A wild-type black-and-orange camouflaged snake synthesizes both black and orange pigments. (b) A black snake does not synthesize orange pigment. (c) An orange snake does not synthesize black pigment. (d) An albino snake synthesizes neither black nor orange pigment. [Anthony Griffiths.) If the presence of on still active, producing th ent do both pathways fa The 9:7 ratio: genes ir brid cross shows both bl- be explained? The 9:7 ra with the 3:3:1 combine The cross of the two wh

Independently synthesized and inherited pigments (a) (b) (c) (d) FIGURE 6-14 In corn snakes, combinations of orange and black pigments determine the four phenotypes shown. (a) A wild-type black-and-orange camouflaged snake synthesizes both black and orange pigments. (b) A black snake does not synthesize orange pigment. (c) An orange snake does not synthesize black pigment. (d) An albino snake synthesizes neither black nor orange pigment. [Anthony Griffiths.) If the presence of on still active, producing th ent do both pathways fa The 9:7 ratio: genes ir brid cross shows both bl- be explained? The 9:7 ra with the 3:3:1 combine The cross of the two wh

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter9: Cell Communication

Section: Chapter Questions

Problem 13TYK: Discuss Concepts There are molecules called GTP analogs that resemble GTP so closely that they can...

See similar textbooks

Similar questions

The first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by Edman degradation and have the sequence:AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK(a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein.(b) What are the cleavage sites using chymotrypsin?
7.What is an allosteric effect? What is are homotropic and heterotropic allostery? Name one example of homotropic allostery. 8.The graph below describes the binding curve of three difference proteins to the same ligand (L). (a) Define what ¤, [L] and Kå signify on this graph. (b) Which protein has the highest affinity for the ligand? (c) Do these proteins bind the ligand cooperatively? Why or why not? (d) For the binding reaction described in the green curve, at which concentration of L would 50% of the binding sites be occupied? Why? Ꮎ 0.5 K=1 nM K=10 nM 0.0+ ŏ K₁ K=100 nM 20 40 60 80 [L] (nM)
The earlier that two genes arose from a duplicated gene, themore their nucleotide sequences can have diverged, which mayresult in amino acid differences in the protein products. (a) Basedon that premise, identify which two genes are most divergentfrom each other. What is the percent amino acid identity betweentheir polypeptides? (b) Using the same approach, identify whichtwo globin genes are the most recently duplicated. What is thepercent identity between them?
The sequence below (A) was read from the autoradiogram (B). (A) 5' TGTACAACTTTTACTTAGGGCCGTGACACCTAAAG. 3' (B) Negative end ACGT Positive end C. Compare the sequence to the autoradiogram. How is the sequence read? Explain your ans d. Suppose that you want to express the correct protein product of an eukaryotic gene in a bacterial cell using a plasmid vector. What single sequence related factor must your consider in the cloning experiment?
A) Upon entering the body, CH3H9+ reacts with cysteine to form a molecule that is able to pass through the blood brain barrier (BBB). Draw the structure of this molecule and purpose why it is able to pass through the BBB (Hint: think about another amino acid). B) The adduct formed in part A is very labile. On encountering selenocysteine, it can permanently inhibit it. Propose how the adduct from Part A inhibits selenocysteine and explain your answer.
Epistatic mteraction means that one gene----------the effect of another gene.(A) Prometic (B) Mask(C) Accelerate(D) None of these
i. A schematic structure of the subunit of hemerythrin (an oxygen-binding protein from invertebrate animals) is shown to the right. (a) It has been found that in some of the a-helical regions of hemerythrin, about every third or fourth amino acid residue is a hydrophobic one. Suggest a structural reason for this finding. (b) What would be the effect of a mutation that placed a proline residue at point A in the structure?
Order+the+following+of+protein+sentesis+sequence+from+earliest: (a)tRNA molecule bring specific amino acids to he mRNA molecule. b)mRNA nucleotides join with exposed DNA bases and form a molecule of mRNA.(c)The two stands of a DNA molecule separate. (d)Peptide bonds form between the amino acids. (e)the mRNA molecule leave the nucleus. (f) a ribosome attached to the mRNA molecule.
(a) How many activation cycles are needed for a protein with 150 amino acids? (b) How many initiation cycles are needed for a protein with 150 amino acids? (c) How many elongation cycles are needed for a protein with 150 amino acids? (d) How many termination cycles are needed for a protein with 150 amino acids?
9.Shown below are the Hill plots of myoglobin (cyan) and an unknown 02 binding protein (magenta). (a) Does this unknown protein bind to 02 cooperatively? If so, is it a positive or negative cooperativity? (b) Does binding of the 1st 02 increase or decrease the affinity for the 2nd O2? (c)What is the minimal number of 02 binding sites that this unknown protein has? Why?
5'– ATGGCGAGGCGGCAGCTGTTATGGTGA – 3' In the sequence above, suppose that the 20th nucleotide of the template (an T) was mutated to a A. (A) Now, what is the mRNA sequence? (B) What is the amino acid sequence of the translated protein? (C) Would this protein be able to carry out its function?
3