BONUS QUESTION! In neurons, the proteolytic enzyme y-secretase produces the Aß amyloid peptides shown below. The AB40 peptide is thought to play a protective role in the neuron. However, the AB42 peptide appearsto be toxic since it is found in the amyloid plaques that cause Alzheimer's Disease (AD). AB40 and AB42 are identical, except that AB42 contains two extra amino acid residues (shown in red) at the C-terminal end. Based onyour knowledge of amino acids and proteins, which of the following factors is most likely to explain the greater plaque-forming activity of AB42 compared to AB40?Sequence of Aß40: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVSequence of AB42: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAO The greater length of AB42 makes it more likely to aggregate and form plaques.O AB42 has a lower pl than AB40, which makes it more likely to aggregate at physiological pH.O AB42 is more hydrophobic than AB40, which makes it harder to clear from the cell and thus more likely to aggregate.O The net charge of AB42 is more positive than AB40, which makes it more likely to aggregate on membranes.O All of the above.

Primary structure of a protein is formed by various amino acids linked together by peptide bonds.…

he greater length of AB42 makes it more likely to aggregate and form plaques. 642 has a lower pl than AB40, which makes it more likely to aggregate at physiological pH. 342 is more hydrophobic than AB40, which makes it harder to clear from the cell and thus more likely to aggregate. he net charge of AB42 is more positive than AB40, which makes it more likely to aggregate on membranes. all of the above.

he greater length of AB42 makes it more likely to aggregate and form plaques. 642 has a lower pl than AB40, which makes it more likely to aggregate at physiological pH. 342 is more hydrophobic than AB40, which makes it harder to clear from the cell and thus more likely to aggregate. he net charge of AB42 is more positive than AB40, which makes it more likely to aggregate on membranes. all of the above.

Human Anatomy & Physiology (11th Edition)

11th Edition

ISBN:9780134580999

Author:Elaine N. Marieb, Katja N. Hoehn

Publisher:Elaine N. Marieb, Katja N. Hoehn

Chapter1: The Human Body: An Orientation

Section: Chapter Questions

Problem 1RQ: The correct sequence of levels forming the structural hierarchy is A. (a) organ, organ system,...

See similar textbooks

Similar questions

quick answers to mc please
4. The graph below represents two different modes of transport across a biological membrane. One employs a membrane protein and the other does not. Which line represents transport with a membrane protein? Label each line with the mode of transport. There are three key characteristics of transport across a biological membrane using a membrane protein. What are these three key features? List and describe each feature. 107 A B Concentration difference across the mebrane Rate of Transport
Add-ons Help Last edit was seconds ago 1oois I UA ext Cardo 12 三ニ三 1 3 5 11. What is/are the difference(s) between active transport and diffusion? How are processes different from phagocytosis or endocytosis? How does the glycocalyx of a bacterium affect its ability to be phagocytosed? What other things does the EPS these do? III
6. Similarities between Panel A and Panel B And 6. Differences between Panel A and Panel B
What would happen to nuclear transport if you removed all of the Ran-GAP? For a while nuclear import receptors will still deliver cargo to the inside of the nucleus Nuclear import receptors will be loaded with RanGTP and will gradually stop binding to the proteins with NLS signals Nuclear export receptors will no longer deliver their cargo to the outside of the membrane and will probably shuttle in and out of the nucleus full of cargo Ran-GDP will no longer be made All of the above
14
6
please help me with this quickly
A main function of the cell membrane is to be very selective as to what is able to cross through, a condition known as a ? barrier. In the fluid mosaic membrane model, lipids are organized in a ? arrangement, such that ? portions of the lipids are exposed to either the interior or exterior of the cell, while the ? lipid portions are sandwiched in the middle of the membrane.
What is the role of lysozyme and a low ionic strength extraction buffer? Select all that apply. Cells absorb water from a low ionic strength extraction buffer, by osmosis, swell and lyse, releasing their contents Lysozyme breaks down bonds in the cellulose cell wall of plants, weakening the structure Cells release water into a low ionic strength extraction buffer by osmosis, shrink and lyse, releasing their contents Lysozyme is an enzyme found in lysosomes in cells Lysozyme breaks down bonds in the peptidoglycan cell wall of bacteria, weakening the structure Lysozyme is an antibiotic found in tears, saliva, human milk and mucus.
Please answer fast Give proper explanation
When the slime mold receives its own autocrine signal of CAMP the response is the activation of transcription of transmembrane adhesion molecules. These adhesion molecules need to be transcribed, translated and shipped to the plasma membrane. This response is an example of O a endocytosis O b. exocytosis Oc. phagocytosis Od. endosomal recycling