B, CThe equations are in the other page. Thanks 1. A recent preprint article e reported pre-clinical evaluations of an inactivated Newcastle disease virus (NDV) chimera stably expressing themembrane-anchored form of the SARS-CoV-2 spike region (NDV-S) as a potent COVID-19 vaccine in mice and hamsters. To design the SFChimera, researchers combined the transmembrane domain and cytoplasmic tail of NDV F protein with the ectodomain of the SARS-CoV-2 Sregion, whose sequence is as follows:MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNEVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPSGAGSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSSGNCDVVIGIVNNTVYDPLOPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKGSGRENLYFQGGGGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHHHHA. Using the equation on Slide 5.3 of Module 1, Lesson 2, calculate the extinction coefficient (without disulfıdes, in Mcm 1) at 280 nmfor this protein. Show all of your work.B. For each of the following amino acid sequences in the protein, predict the most likely secondary structure. (Is it more likely to be partof an a- helix, ß sheet, a reverse turn, etc.?) Explain why."Note: Although you may use the DSSP algorithm (among others) to provide the prediction, you should still explain what features of the aminoacid sequence make it more likely to be part of a type of secondary structure to receive full credit.1: TNVVIKVC2: SAIGKIQD3: SETKCTLK4: INLVRDLP5: VLHSTQDL6: KIADYNYKC. If you wanted to covalently attach a single fluorescent label to this protein, what are two types of reagents would you use? Be sure togive specific examples, provide details about the chemical mechanism, and explain your choice. EquationsSide S.3.Ea80 (M-' cm-1) == (5500 x nerp) + 1470 x nar) t (125 + nos)Şide li10R- COOH = RC00 + HtK = [RCO0] + [H*][RCOO H]KX acidic[H*]%3D[H*][H*]Slide 1.8pI = ţ Cpk; + pK;)pl(pkit pka)I (pke+ pKz)

"Since you have asked multiple questions, we will solve the B question for you. If you want a…

B. For each of the following amino acid sequences in the protein, predict the most likely secondary structure. (Is it more likely to be part of an a- helix, B sheet, a reverse turn, etc.?) Explain why. "Note: Although you may use the DSSP algorithm (among others) to provide the prediction, you should still explain what features of the amino acid sequence make it more likely to be part of a type of secondary structure to receive full credit. 1: TNVVIKVC 2: SAIGKIQD 3: SETKCTLK 4: INLVRDLP 5: VLHSTQDL 6: KIADYNYK

B. For each of the following amino acid sequences in the protein, predict the most likely secondary structure. (Is it more likely to be part of an a- helix, B sheet, a reverse turn, etc.?) Explain why. "Note: Although you may use the DSSP algorithm (among others) to provide the prediction, you should still explain what features of the amino acid sequence make it more likely to be part of a type of secondary structure to receive full credit. 1: TNVVIKVC 2: SAIGKIQD 3: SETKCTLK 4: INLVRDLP 5: VLHSTQDL 6: KIADYNYK

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Similar questions

Question 9 Imagine you have a mixture of 2 proteins. Protein A is 3x the mass of protein B. Both have net negative charges, but protein B has 3x more negative charges than protein A. If you load the mixture onto an electrophoresis gel and apply an electric field, which will move faster/slower through the gel? Explain your reasoning.
Question 9. // Help solve the picture and the questions that were cut off from the picture attached. What are the molecular weights of the protein X polypeptides? (pick 1 only)- 50 kDa each- 60 kDa and 30 kDa- 70 kDa and 30 kDaWhat are the molecular weights of the protein Y polypeptides? (pick 1 only)- 60 kDa, 50 kDa, and 30 kDa- 50 kDa each- 60 kDa and 30 kDa
Question 6a and 6b explained
We got you something. a. I love it! I'm going to share it with EVERYONE! Othewwerden Explain what is going on in this cartoon: What do the pink and red characters represent?
Question 14 a) Radioactive decay produces ionising radiation. Like all ionising radiation this can lead to harmful effects on living tissue due to cell damage including damage to DNA, mutation and cell death. Contrast the differing health risks associated when working with alpha, beta or gamma radiation sources. b) Describe some ways in which those working with radioactive sources and people in general can be protected against the risks of radiation exposure from such sources.
Enzymes display a very high degree of ________________, which is the ability to discriminate between very similar molecules.
Question 3 a) Explain the key properties Tc 99m used for medical imaging. b) Explain how you store such radioisotope. [Suggested word count 200] [1.3]
Question 8 of 26 Suppose a drug molecule binds to a protein target. Complete the table which describes possible noncovalent interactio (NCI) in the binding site. Assume the drug has a variety of types of polar and nonpolar regions. Type of NCI ionic interaction dipole-dipole Species able to form that NCI any species with permanent dipoles (C=O, etc.) H bonded to N, O, or F and a lone pair on N.O.or F Answer Bank dielectric size; type of charge ions; charged species hp dispersion Parameters affecting the NCI hydrogen bond strength and orientation of dipole orientation polarizability; size; molecular weight
31
Question 1. Enzymes, proteins and deoxyribonucleic acid (DNA) are important biological macromolecules. Enzymes are not only speed up the reaction, but also are necessary for DNA reproduction. e) Michaelis - Menten Kinetics model explains how reaction rates are depending on the concentration of enzyme and substrate. i. What is meant by the saturation of enzyme? ii. A decrement in enzyme activity is known as enzyme inhibition. Based on normal enzyme activity, explain the enzyme kinetics for competitive inhibition and noncompetitive inhibition, as shown in Figure 1. Normal enzyme Competitive inhibitor Noncompetitive inhibitor Substrate concentration Figure 1: Enzyme inhibition f) What is the importance of cofactor in the enzyme activity? Give an example of a disease that is related with cofactors. Rate of reaction
Question 1
P(A-a)O2 ranges