Concept explainers
(a)
Interpretation: The validation about the given molecule that it exists in left-handed and right-handed forms has to be predicted.
Concept introduction: Handedness is a form of isomerism. Many molecules, including the carbohydrates possess this property. Those molecules that possess this property exist either in right-handed form or left-handed form. These are related to each other in a similar way as the pair of hands. These forms are mirror images of each other.
(b)
Interpretation: The validation about the given molecule that it exists in left-handed and right-handed forms has to be predicted.
Concept introduction: Handedness is a form of isomerism. Many molecules, including the carbohydrates possess this property. Those molecules that possess this property exist either in right-handed form or left-handed form. These are related to each other in a similar way as the pair of hands. These forms are mirror images of each other.
(c)
Interpretation: The validation about the given molecule that it exists in left-handed and right-handed forms has to be predicted.
Concept introduction: Handedness is a form of isomerism. Many molecules, including the carbohydrates possess this property. Those molecules that possess this property exist either in right-handed form or left-handed form. These are related to each other in a similar way as the pair of hands. These forms are mirror images of each other.
(d)
Interpretation: The validation about the given molecule that it exists in left-handed and right-handed forms has to be predicted.
Concept introduction: Handedness is a form of isomerism. Many molecules, including the carbohydrates possess this property. Those molecules that possess this property exist either in right-handed form or left-handed form. These are related to each other in a similar way as the pair of hands. These forms are mirror images of each other.
Want to see the full answer?
Check out a sample textbook solutionChapter 18 Solutions
GENERAL,ORGANIC,+BIO.CHEM.-MINDTAP
- You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280?? or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280??? Select the best answer. Measuring absorbance at higher wavelengths, like 595?? or 562??, is more accurate than measuring absorbance at…arrow_forwardWhy is it 2n-2?arrow_forwardWhat is the family-name ending for a sugar?arrow_forward
- Why are PI and PII are so called? What are the end products of each of these cycles?arrow_forwardWhat is the expected molecular weight of the protein encoded by the sequence provided here: ATGGCGCACGCTGGGAGAACAGGGTACGATAACCGGGAGATAGTGATGAAGTACATCCATTATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCGGGAGATGTGGGCGCCGCGCCCCCGGGGGCCGCCCCCGCACCGGGCATCTTCTCCTCCCAGCCCGGGCACACGCCCCATCCAGCCGCATCCCGGGACCCGGTCGCCAGGACCTCGCCGCTGCAGACCCCGGCTGCCCCCGGCGCCGCCGCGGGGCCTGCGCTCAGCCCGGTGCCACCTGTGGTCCACCTGACCCTCCGCCAGGCCGGCGACGACTTCTCCCGCCGCTACCGCCGCGACTTCGCCGAGATGTCCAGCCAGCTGCACCTGACGCCCTTCACCGCGCGGGGACGCTTTGCCACGGTGGTGGAGGAGCTCTTCAGGGACGGGGTGAACTGGGGGAGGATTGTGGCCTTCTTTGAGTTCGGTGGGGTCATGTGTGTGGAGAGCGTCAACCGGGAGATGTCGCCCCTGGTGGACAACATCGCCCTGTGGATGACTGAGTACCTGAACCGGCACCTGCACACCTGGATCCAGGATAACGGAGGCTGGGTAGGTGCACTTGGTGATGTGAGTCTGGGCTGAarrow_forward1) You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide |protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280nm? Select the best answer. a) Measuring absorbance at higher wavelengths, like 595nm or 562nm, is more accurate than measuring absorbance at 280nm. b) The Bradford…arrow_forward
- In humans, PKU (phenylketonuria) is a recessive disease caused by an enzyme inefficiency at step A in the following simplified reaction sequence, and AKU (alkaptonuria) is another recessive disease due to an enzyme inefficiency in one of the steps summarized as step B here:phenylalanine tyrosine CO2 H2O A B A person with PKU marries a person with AKU. What phenotypes do you expect for their children? All normal, all having PKU only, all having AKU only, all having both PKU and AKU, or some having AKU and some having PKU?arrow_forwardWhy is the AT base pair less stable than the GC base pair?arrow_forwardPectin, which occurs in plant cell walls, exist in nature as a polymer of D-galacturonic acid methylated at carbon 6 of the monomer. Draw a haworth projection for a repeating disaccharide unit of pectin with one methylated and one unmethylated monomer unit in a (1-->4) linkagearrow_forward
- What contributes to the asymmetric protein distributions ?arrow_forward5-Bromouridine is known to induce mutations in DNA. One of the characteristics of this compound is that the enol form is favored relative to the keto form. Draw the keto- and the eno- tautomers of the base. Determine (and draw) which base (A, T, G, or C) would most likely interact with each of the two forms by base-pair.arrow_forwardDraw a tripeptide only containing Alaninearrow_forward
- Principles Of Radiographic Imaging: An Art And A ...Health & NutritionISBN:9781337711067Author:Richard R. Carlton, Arlene M. Adler, Vesna BalacPublisher:Cengage Learning