Concept explainers
(a)
Interpretation: The validation about the given molecule being achiral has to be stated.
Concept introduction: A center to which four different groups are attached in a tetrahedral geometry and show handedness is called chiral center. The molecule containing the chiral center is called chiral molecule.
(b)
Interpretation: The validation about the given molecule being achiral has to be stated.
Concept introduction: A center to which four different groups are attached in a tetrahedral geometry and show handedness is called chiral center. The molecule containing the chiral center is called chiral molecule.
(c)
Interpretation: The validation about the given molecule being achiral has to be stated.
Concept introduction: A center to which four different groups are attached in a tetrahedral geometry and show handedness is called chiral center. The molecule containing the chiral center is called chiral molecule.
(d)
Interpretation: The validation about the given molecule being achiral has to be stated.
Concept introduction: A center to which four different groups are attached in a tetrahedral geometry and show handedness is called chiral center. The molecule containing the chiral center is called chiral molecule.
Want to see the full answer?
Check out a sample textbook solutionChapter 18 Solutions
GENERAL,ORGANIC,+BIO.CHEM.-MINDTAP
- Sketch the titration curve for the amino acid alanine with pka1 = 2.34 and pka2 = 9.69.arrow_forwardDraw a structural formula for a nucleoside composed of the following. Q.) b-2-Deoxy-d-ribose and cytosinearrow_forwardAvidin exists as a protein complex of around 68 kDa. Research to determine the types of interactions that hold the avidin complex together. Based on your research, which molecular weight would you expect for avidin when treated with beta-mercaptoethanol and run through an SDS-PAGE gel? Question options: 34 kDa 19 kDa 68 kDa 11 kDaarrow_forward
- You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280?? or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280??? Select the best answer. Measuring absorbance at higher wavelengths, like 595?? or 562??, is more accurate than measuring absorbance at…arrow_forwardHow many moles of EDTA (C10H16N2O3) do you have in 785µl of a 74MM EDTA solution (Mr(C10H16N203) = 292.24)? Consider all digits of your Givens significant. Round results to the appropriate number of Significant Digits. The number of moles is mmol.arrow_forwardnumber 5-21arrow_forward
- Draw the four stereoisomers of threonine as Fischer projections.arrow_forwardcalculate the pI for tripeptide R-H-Darrow_forwardComplete the following table by providing the Fischer and Haworth Projections of the given sugars. (Please be careful with the alpha and beta, and the complete and abbreviated) (not a graded question) Sugar Fischer Projection Haworth Projection (Complete) alpha-anomer Haworth Projection (Abbreviated) beta-anomer L-Galactose L-Fructosearrow_forward
- When the amino acid sequences of insulin isolated from differentorganisms were determined, some differences were noted.For example, alanine was substituted for threonine, serine wassubstituted for glycine, and valine was substituted for isoleucineat corresponding positions in the protein. List the single-basechanges that could occur in triplets to produce these amino acidchanges.arrow_forwardPlease explain the results and conclusion based on the results of these two chromatograms (one for proteins and one for nucleic acids). For the proteins chromatogram, the Xs on the line from left to right are: unhydrolyzed protein hydrolyzed protein alanine solution histidine solution aspartic acid solution lysine solution methionine solution a solution containing an unknown amino acid (it will be 1 of the 5 amino acids found in microfuge numbers #3 to #7 above) For the nucleic acid chromatogram, the Xs on the line from left to right are: unhydrolyzed nucleic acid hydrolyzed nucleic acid adenine solution cytosine solution uracil solution adenine-cytosine-uracil solution #1 and #2 for both proteins and nucleic acid chromatogram was prepared with yeast cells and centrifugation. Yeast was grinded down with sand and then TCA (trichloroacetic acid) The yeast contains yeast cells held together with a starchy binding material. Glucan (a cellulose-like polysaccharide) is present in the…arrow_forwardPlease explain the results and conclusion based on the results of these two chromatograms (one for proteins and one for nucleic acids). For the proteins chromatogram, the Xs on the line from left to right are: unhydrolyzed protein hydrolyzed protein alanine solution histidine solution aspartic acid solution lysine solution methionine solution a solution containing an unknown amino acid (it will be 1 of the 5 amino acids found in microfuge numbers #3 to #7 above) For the nucleic acid chromatogram, the Xs on the line from left to right are: unhydrolyzed nucleic acid hydrolyzed nucleic acid adenine solution cytosine solution uracil solution adenine-cytosine-uracil solution #1 and #2 for both proteins and nucleic acid chromatogram was prepared with yeast cells and centrifugation. Yeast was grinded down with sand and then TCA (trichloroacetic acid) The yeast contains yeast cells held together with a starchy binding material. Glucan (a cellulose-like polysaccharide) is present in the…arrow_forward
- Principles Of Radiographic Imaging: An Art And A ...Health & NutritionISBN:9781337711067Author:Richard R. Carlton, Arlene M. Adler, Vesna BalacPublisher:Cengage Learning