The chain 3 subunit contains the amino acid sequence shown below. This sequence contains one alpha helix and the rest is random coil. Mark the region you believe will contain the alpha helix and explain your choice. In needed, feel free to use a helix wheel or other tools as part of your explanation. MNTFIIFIILIPIVGFALLAVNILLAVYKP
Nucleotides
It is an organic molecule made up of three basic components- a nitrogenous base, phosphate,and pentose sugar. The nucleotides are important for metabolic reactions andthe formation of DNA (deoxyribonucleic acid) and RNA (ribonucleic acid).
Nucleic Acids
Nucleic acids are essential biomolecules present in prokaryotic and eukaryotic cells and viruses. They carry the genetic information for the synthesis of proteins and cellular replication. The nucleic acids are of two types: deoxyribonucleic acid (DNA) and ribonucleic acid (RNA). The structure of all proteins and ultimately every biomolecule and cellular component is a product of information encoded in the sequence of nucleic acids. Parts of a DNA molecule containing the information needed to synthesize a protein or an RNA are genes. Nucleic acids can store and transmit genetic information from one generation to the next, fundamental to any life form.
![### Amino Acid Sequence Analysis: Identifying Alpha Helix Regions
#### Description:
**Exercise:**
The chain 3 subunit contains the amino acid sequence shown below. This sequence contains one alpha helix, while the rest is random coil. Mark the region you believe will contain the alpha helix and explain your choice. If needed, feel free to use a helix wheel or other tools as part of your explanation.
**Amino Acid Sequence:**
```
MNTFIIFIILPIVGFALLAVNILLAVVKP
```
#### Instructions:
1. **Identify Alpha Helix Region:**
- Analyze the given amino acid sequence.
- Identify which segment of the sequence likely forms the alpha helix.
2. **Explanation:**
- Explain your reasoning for selecting the specific region as an alpha helix.
- Utilize tools such as the helix wheel, hydrophobicity scales, or any other relevant biochemical tools to support your choice.
#### Tools and Tips:
- **Helix Wheel:** A helix wheel can help visualize the helical structure and is useful for identifying patterns indicative of alpha helices.
- **Hydrophobicity Scales:** Amino acids that are more hydrophobic (like alanine, leucine, and valine) tend to be found within alpha helices as these structures often reside inside proteins away from aqueous environments.
By carefully analyzing the sequence with these tools, researchers and students can predict secondary structures, thereby enhancing their understanding of protein folding and function.](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2Fcd7a0374-f414-4e0c-9a39-f312d4f3b754%2F0acb32b4-3733-4d91-bd89-d4904d030a5f%2Fy7lz3sp_processed.jpeg&w=3840&q=75)
![](/static/compass_v2/shared-icons/check-mark.png)
Step by step
Solved in 2 steps with 1 images
![Blurred answer](/static/compass_v2/solution-images/blurred-answer.jpg)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781319114671/9781319114671_smallCoverImage.jpg)
![Lehninger Principles of Biochemistry](https://www.bartleby.com/isbn_cover_images/9781464126116/9781464126116_smallCoverImage.gif)
![Fundamentals of Biochemistry: Life at the Molecul…](https://www.bartleby.com/isbn_cover_images/9781118918401/9781118918401_smallCoverImage.gif)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781319114671/9781319114671_smallCoverImage.jpg)
![Lehninger Principles of Biochemistry](https://www.bartleby.com/isbn_cover_images/9781464126116/9781464126116_smallCoverImage.gif)
![Fundamentals of Biochemistry: Life at the Molecul…](https://www.bartleby.com/isbn_cover_images/9781118918401/9781118918401_smallCoverImage.gif)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781305961135/9781305961135_smallCoverImage.gif)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781305577206/9781305577206_smallCoverImage.gif)
![Fundamentals of General, Organic, and Biological …](https://www.bartleby.com/isbn_cover_images/9780134015187/9780134015187_smallCoverImage.gif)