The CFTR membrane protein hasS an alpha helix that spans the membrane. The amino acid sequence of the central portion of this alpha helix, which is embedded within the membrane, is which one of the sequences below? Sequences are provided in the single letter code. O a. vvVLVVVVLVVLLLVL b. EEEREEEEREERRRER C. VVVLVVVVREERRRER d. VVVEVVVVEVVEEEVE

The CFTR membrane protein hasS an alpha helix that spans the membrane. The amino acid sequence of the central portion of this alpha helix, which is embedded within the membrane, is which one of the sequences below? Sequences are provided in the single letter code. O a. vvVLVVVVLVVLLLVL b. EEEREEEEREERRRER C. VVVLVVVVREERRRER d. VVVEVVVVEVVEEEVE

Human Heredity: Principles and Issues (MindTap Course List)

11th Edition

ISBN:9781305251052

Author:Michael Cummings

Publisher:Michael Cummings

Chapter9: Gene Expression And Gene Regulation

Section: Chapter Questions

Problem 16QP: Given the following tRNA anticodon sequence, derive the mRNA and the DNA template strand. Also,...

See similar textbooks

Similar questions

TAC/ACC/GAC/GAA/AAT/TGT/TAC/CGT/TCA/AAC asap please
The peptide hormone oxytocin induces labor by stimulating the concentration of uterine smooth muscle. Its amino acid sequence is as follows: Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly.Write a messenger RNA sequence for that sequence. Write the sequence of the two strands of DNA nucleotides that carry the information. for that protein.
A strand of DNA contains this nucleotide sequence: TACTGCCTCCCCATAAGAATT. The corresponding nucleotide sequence of the mRNA strand from this DNA template is as follows: AUGACGGAGGGGUAUUCUUAA. Q: What is the amino acid sequence of the polypeptide that is produced form the mRNA strand? As well, draw a labelled diagram of the mRNA molecule being transcribed from this strand of DNA.
Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?
Compare the two DNA sequences shown below and consider the single nucleotide mutation made in the lower DNA sequence (shown in bold font). This is an example of a mutation. DNA: ATG CGC ТСС САТ стт ААС АAА GAG GTT GG C TAT TT Protein: Met-Arg-Ser-His-Leu-Asn-Lys-Glu-Ala-Gly-Tyr-Phe DNA: АTG CGC ТСС САТ стТ ААС АAG GAG GTT GGC ТАТ ТТT Protein: Met-Arg-Ser-His-Leu-Asn-Lys-Glu-Ala-Gly-Tyr-Phe missense nonsense frame-shift silent antisense
Use the chart below to find the correct amino acids for the following mRNA strand: GCUAUGUUU ala-met-stop ala-met-stop ala-met-phe phe-ala-met
Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
If the sequence of mRNA is 5'-AAUCGUACGGAUGCCGAAAUACCCAUUAGGGAUUGCAUAGCGAGCAACGGAC-3', what is the amino acid sequence it would make? Note: Use one-letter abbreviation for the amino acid sequence Sample answer format: MIGHTY
The following segment of DNA codes a protein. The uppercase letters represent Exons, the lowercase letters introns. Draw the pre- mRNA, the mature mRNA and translate the codons using the genetic code to form the protein. Identify the 5’UTR and 3UTR 5’- AGGAAATGAAATGCCAgaattgccggatgacGGTCAGCaatcgaGCACATTTGTGATTTACCGT-3’
A segment of a polypeptide chain is Arg-Gly-Ser-Phe-Val-Asp-Arg. It is encoded by the following segment of DNA: GGCTAGCTGCTTCCTTGGGGA CCGATCGACGAAGGAACCCCT Note out the mRNA sequence generated by the template strant to produce that polypeptide chain Label each stran with its correct polarity (5' and 3' ends on each strand)
Write corresponding mRNA code and the amino acid acid sequence for the DNA segment with the following code: 5’-ACT-ACT-CTA-AGC-CCC-TAC-CCG-3’
The sequence of coding strand of a DNA molecule is given below. Assume that it is read from left to right. CCTACCTTATGCCAAGTTGGGGATAAACTC The left end of this molecule is the end. How many amino acids will be in the protein translated from this sequence? What is the name (not abbreviation) of the fourth amino acid in the protein translated from this sequence? The label on the end of the protein that is translated first is the + Jend.