Problem 3Suppose that thermal stability experiments have given the following (partial) thermodynamic datafor denaturing of a protein in aqueous solution at pH 7.4 at different temperatures:ΔΗ.(kJ/(mol))KegAĞ°ASFraction of protein(°C)(kJ/mol)(J/(mol•K))molecules denatured450.1335.33150.0a ?b?50c?2.86175.0d?e ?55f?200.0609.8603.22h?225.0i?j?Fill in the missing values in the table labeled (a) – (j).

∆G=∆H-T∆S 5.33 *10^3 = 150*10^3 -(45+273)(∆S) (45+273)(∆S) = (150-5.33) *10^3 (∆S)= (144.67*10^3)/…

Próblém Suppose that thermal stability experiments have given the following (partial) thermodynamic data for denaturing of a protein in aqueous solution at pH 7.4 at different temperatures: ΔΗ (kJ/(mol)) Fraction of protein AĞ° (kJ/mol) Кед AS (°C) g/(mol•K)) a ? molecules denatured 45 0.133 5.33 150.0 b? 50 c? 2.86 175.0 d? e ? f? 200.0 g? j? 55 609.8 60 3.22 h? 225.0 i? Fill in the missing values in the table labeled (a) – (j).

Próblém Suppose that thermal stability experiments have given the following (partial) thermodynamic data for denaturing of a protein in aqueous solution at pH 7.4 at different temperatures: ΔΗ (kJ/(mol)) Fraction of protein AĞ° (kJ/mol) Кед AS (°C) g/(mol•K)) a ? molecules denatured 45 0.133 5.33 150.0 b? 50 c? 2.86 175.0 d? e ? f? 200.0 g? j? 55 609.8 60 3.22 h? 225.0 i? Fill in the missing values in the table labeled (a) – (j).

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Similar questions

9. Which of the following non-covalent interactions could the sidechain of F266 participate in. Place an "X" next to all that apply. lonic (or salt bridge or charge-charge) Hydrogen bond Dipole-dipole Dipole-induced dipole Induced dipole-induced dipole Charge-dipole Charge-induced dipole П-stacking 10. The thermodynamic values for the folding of a protein are as follows: AG° = -38 kJ/mol = AH° = -164 kJ/mol AS -0.68 kJ/K.mol Which one of the following statements is most likely true? Circle your answer. A. Folding of this protein is primarily driven by the formation of favorable noncovalent interactions in the folded protein. B. Folding of this protein is primarily driven by the formation of hydrogen bonds between the protein and the bulk solvent (water). C. Folding of this protein is primarily driven by the loss of conformational entropy in the folded protein. D. Folding of this protein is primarily driven by the gain of conformational entropy in the folded protein. E. Folding of this…
Q6-1 Formation of DNA is pairing up RNA. In solution containing two RNA moving independently. When DNA forms, two RNA fuse. DNA seems more ordered than two independent RNA Yet, formation of DNA is spontentanious. Explain why that is the case Q6-2 Is it possible to make AG, H,O(s) = AG, H,O(g). if it is possible, give an example. Otherwise, explain why this can not happen.
Researchers analysed a glycopeptide (a peptide carrying one or several oligosaccharide groups) and determined both the sequence of the peptide and the sequence of the sugar molecule. The latter was identified as a diholoside coupled to the peptide by an osidic bond. The systematic name of this sugar is: B-D-glucopyranosyl-(1→4)-ß-D-galactopyranose. : Represent the chemical formula of this diholoside in a way that all oses are Question 1 represented according to the Haworth convention. Apart from the furane and/or pyrane cycles all atoms of this molecule must be given.
Refer to the bar graph below, Explain why the n→π* interactions contributes more to the overall stabilization of the protein than all the other interactions(C-H-O hydrogen bond,π-π interactions, C5 Hydrogen Bonds, Cation-π interactions, Sulfur-arene interactions, Anion-π interactions, Chalcogen bonds, X-H-π interactions) even though n→π* is the weaker interaction. Explain why that's the case for EACH of the bonds. I.e Why n→π* interactions contribute more to the overall stabilization of the protein than C-H-O hydrogen bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than π-π interactions even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than C5 Hydrogen Bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than Cation-π interactions, even though…
Kk.335.
Amino Acids and Proteins 1. What are the structural features of amino acids with an emphasis on essential amino acids? 2. Write the properties of amino acids: zwitterion, pka, pKb, amphoteric character, isoelectric point, and electrophoresis. 3. Write the mechanism of peptide bond formation and what are its structural features. 4. What are the different types of proteins and their function? 5. Explain the meaning and importance of the primary, secondary, tertiary, and quaternary structures of a protein and the factors that cause its denaturation.
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
Refer to the bar graph below, Explain why the n→π* interactions contributes more to the overall stabilization of the protein than all the other interactions(C-H-O hydrogen bond,π-π interactions, C5 Hydrogen Bonds, Cation-π interactions, Sulfur-arene interactions, Anion-π interactions, Chalcogen bonds, X-H-π interactions) even though n→π* is the weaker interaction. Explain why that's the case for EACH of the bonds. I.e Why n→π* interactions contribute more to the overall stabilization of the protein than C-H-O hydrogen bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than π-π interactions even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than C5 Hydrogen Bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than Cation-π interactions, even though…
what intermolecular forces between the interaction of A475 and S19
indicate the RIGHT alternative: (a) The Zwitterion form of an amino acid exists only at a point pH value. (b) In a peptide bond there is free rotation at the C-N bond. (c) In a polypeptide, the terminal carboxyl group may be present in its amide form. (d) At a pH greater than pI, an amino acid tends to move towards the cathode in an electrophoresis. (e) At any pH below pI, the predominant form of an amino acid is negatively charged.
Calculate the isolelectric point of the following tetrapeptide, IHGK. The pK, of the N-term is 9.59 and the pK, of the C-term is 2.29.
Past paper