Imagine the main chain of a protein bends back on itself, so that two amino acid residues R, and R₂ come close to each other. In the table below are four possibilities for what R, and R₂ might be. In each case, decide whether a specific interaction could form between th residues. If a specific interaction could form, give the name of the interaction. R₁ R₂ specific interaction? name of specific interaction X 5 O yes valine phenylalanine hydrogen bonding O no O yes threonine tyrosine hydrogen bonding O no O yes lysine glutamate O no phenylalanine serine O yes О по O Explanation Check 3 W E R % 5 7 8 LLC. All Rights Reserved Terms of Use Privacy Comer G H K Z X V B N M alt H option cmd P H alt cmd op

Imagine the main chain of a protein bends back on itself, so that two amino acid residues R, and R₂ come close to each other. In the table below are four possibilities for what R, and R₂ might be. In each case, decide whether a specific interaction could form between th residues. If a specific interaction could form, give the name of the interaction. R₁ R₂ specific interaction? name of specific interaction X 5 O yes valine phenylalanine hydrogen bonding O no O yes threonine tyrosine hydrogen bonding O no O yes lysine glutamate O no phenylalanine serine O yes О по O Explanation Check 3 W E R % 5 7 8 LLC. All Rights Reserved Terms of Use Privacy Comer G H K Z X V B N M alt H option cmd P H alt cmd op

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Similar questions

The following graph shows the activity versus pH curve for pepsin, an enzyme that breaks down proteins into smaller peptides. Estimate its optimum pH. Maximum activity No activity pH 0 pH 3.8 pH 2 O pH4 Pepsin 01 2 3 pH 4 5
Refer to the bar graph below, Explain why the n→π* interactions contributes more to the overall stabilization of the protein than all the other interactions(C-H-O hydrogen bond,π-π interactions, C5 Hydrogen Bonds, Cation-π interactions, Sulfur-arene interactions, Anion-π interactions, Chalcogen bonds, X-H-π interactions) even though n→π* is the weaker interaction. Explain why that's the case for EACH of the bonds. I.e Why n→π* interactions contribute more to the overall stabilization of the protein than C-H-O hydrogen bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than π-π interactions even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than C5 Hydrogen Bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than Cation-π interactions, even though…
1. Determine whether each of the following statements describes the primary, secondary, tertiary, or quaternary stucture of a protein. а. Peptide bonds join amino acids in a polypeptide chain. b. Two polypeptide chains are held together by hydrogen bonds. С. Hydrogen bonds form between adjacent segments of the backbone of the same protein to form a "folded fan" structure. 2. List the type of denaturing agent described by the following treatments: a. disrupting the disulfide bonds in hair to straighten it b. baking the proteins in dough to make bread
Highlight each peptide bond in the molecule below. In addition, list the common names of the smaller molecules that would be released if all the peptide bonds were hydrolyzed. You can add more rows to the table if you need to. (Note: you do not need to list water.) If there are no peptide bonds in the molecule, just check the no peptide bonds box below the drawing area. Ono peptide bonds Add Row I Don't Know H₂N-C Submit CH₂ CH C–NH–CH—CO0 CH, CH3 molecules released if peptide bonds hydrolyzed (list one name per row) 0 CH3 00 X S X 3 alo Ar © 2023 McGraw Hill LLC. All Rights Reserved. Terms of Use | Privacy Center Accessibility
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
Refer to the bar graph below, Explain why the n→π* interactions contributes more to the overall stabilization of the protein than all the other interactions(C-H-O hydrogen bond,π-π interactions, C5 Hydrogen Bonds, Cation-π interactions, Sulfur-arene interactions, Anion-π interactions, Chalcogen bonds, X-H-π interactions) even though n→π* is the weaker interaction. Explain why that's the case for EACH of the bonds. I.e Why n→π* interactions contribute more to the overall stabilization of the protein than C-H-O hydrogen bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than π-π interactions even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than C5 Hydrogen Bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than Cation-π interactions, even though…
Identify the features of the two bonded amino acids depicted in the image. HOHH | || | | N-C-C-N-C-C CH CH₂2 CH₂2 CH₂ CH₂ I I CH₂ CH₂ NH₂+ O OH Answer Bank hydrophilic side chain hydrophobic side chain peptide bond carboxyl group amino group
Bovine chymotrypsinogen has a molecular weight of 25.6 kDa. Amino acid analysis shows that this enzyme is 9% alanine (Mr 89.1). Calculate how many alanine residues are present in a molecule of bovine chymotrypsinogen. Round your answer to the nearest whole number.
Answered proteln structure 1 Which is an example of primary protein structure? Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer a. Multiple folded protein chains create an overall shape of a protein complex, b Amino acids form a particular sequence of residues A protein contains many alpha helices. A protein folds around itselrto exposehydrophilic groups on its surface
Proteins 1 and 2 interact strongly. A significant part of the interaction is between the amino acid side chains shown below. Protein 1= arginine C6H14N402 . Protein 2 = glutamic acid C5H9NO4 A mutation occurs in protein 2 that changes the amino acid shown above to one of the amino acids shown below. What change should disrupt the interaction between proteins 1 and 2 the most? the least? Protein 2- aspartic acid C4H7NO4, protein 2= Lysine C6H14N20 Protein 2= serine C3H7NO3 and protein 2= leucine C6H13NO2 aspartic acid would be the most and leucine would be the least aspartic acid would be the most and serine would be the least lysine would be the most and serine would be the least lysine would be the most and aspartic acid would be the least
Differentiate and explain the chemical basis of the Kjeldahl, Lowry and Bradford techniques that can be used to quantitate proteins in quality control and research.