Genskap/Property A-DNA B-DNA Z-DNA Algehele proporsies/Overall Kort en 1.3.1 Verleng en proportions breed/short and dun/elongated and thin broad 1.3.2 Regshandig/right- Regshardig/right- Linkshandig/Left- handed handed handed Basepare per heliksdraai/base 1.3.3 10 12 pare per turn of helix 1.3.4 anti anti anti (C), syn (G)
Q: Using the data in this table, what is the AG° (in KJ/mol) for the reduction of FAD by water
A: The change in free energy is indicative of whether a reaction is spontaneous or not. If a reaction…
Q: Neurotransmitters of inhibitory signal makes the membrane potential more positive. Select one: O…
A: Hi, thank you for posting the question on Bartleby. As per the guidelines, we are authorized to…
Q: 2. What conclusion may be drawn about the possibility of a solution of pure soap in distilled water…
A: Soap is produced by the saponification reaction or hydrolysis of fat .The soaps are mostly fatty…
Q: Glucocorticoid use results in in the amount of glucose that is taken up into muscle cells and…
A: One of the class of corticosteroid is glucocorticoids, which ate class of steroid hormones.…
Q: Phosphofructokinase (PFK-1) is ____ when ATP levels are low, and ____ when ATP levels are high. a…
A: Phospho Fructo Kinase 1, PFK1 is an important Enzyme of Glycolysis that convert fructose 6 phosphate…
Q: In Zak-Henley's method in Determination of Total Serum Cholesterol, determine role of the sulfuric…
A: Cholesterol is a type of steroid. The normal serum cholesterol is 125-200mg/dL. Elevated serum…
Q: What aeration condition (presence or absence of O2) favors cell growth? What is the metabolic…
A: Aeration means the presence of oxygen and anaerobic condition means the absence of oxygen. The…
Q: hich of the following play an important role in synthesis of DNA/RNA: a.B-12 b.Folic acid c.Sodium…
A: The RNA is synthesized by RNA polymerase enzymes from a DNA template through DNA transcription.…
Q: Match the following descriptions with the correct lipid-based compounds:…
A: Lipids are a class of compounds that are insoluble in water and soluble in nonpolar solvents. Lipids…
Q: this be done in bond line
A: No.
Q: Amanufacturer of a line of patentmedicines is preparing a production plan on medicines A and B.…
A: Decision variable: A = bottles of medicine A (1000 units) B = bottles of medicine B (1000 units)…
Q: Saponification is a process by which triacylglycerols are hydrolyzed to produce glycerol and fatty…
A: Triglycerides have a glycerol backbone with the hydroxyl groups esterified with fatty acids.
Q: Complete table 2. * Since you were not able to conduct an actual experiment on these tests, kindly…
A: Bromine test is a qualitative analysis of organic chemistry to detect unsaturation, anilines and…
Q: Choose all that aplly that are TRUE for the lipid bilayer: Negative mark is given to incorrect…
A: A lipid bilayer is described as a very thin layer that is made up of two different layers of…
Q: the first two reactions in glycolysis associated with unfavorable ∆G° values, i.e., ∆G° > 0, both…
A: Glucose molecules are metabolized through the glycolytic pathway to release energy in the form of…
Q: Match the following methods of Analysis Fractional analysis, methylation, and periodate oxidation A.…
A: Methods of analysis are different techniques used to analyse a compound for determination of its…
Q: Give the functions of both water-soluble and fat-soluble vitamins
A: The B vitamins (folate, thiamine, riboflavin, niacin, pantothenic acid, biotin, vitamin B6, and…
Q: Show a chemical reaction involving hydrogen peroxide and the enzyme present in potato. What enzyme…
A: Chemical reactions and processes are sped up by catalysts or chemicals found in all living things.…
Q: a) what hormone is high scereted in this condition?
A: Insulin
Q: A patient is prescribed 15mmol of potassium chloride injection. The ampoule contains 20mmol in 10ml.…
A: Given data A 10 ml ampule contains = 20 mmol
Q: Match each Sl unit to the quantity it measures. degree Fahrenheit second gram kelvin nanosecond…
A: A unit of measurement is a conventionally defined magnitude of a quantity, that is used as a…
Q: Antagonist binds to the enzyme at a site far away from the receptor site to inhibit the function of…
A: Glycolysis converts glucose to pyruvate which is then oxidized to carbon dioxide and water by the…
Q: b) Consider the following experimental results: Total hydrolysis of a nonapeptide gave:…
A: Proteins or peptides are made up of twenty standard amino acids that are attached together via…
Q: The following bond makes bovine pancreatic trypsin inhibitor as one of the stable proteins.…
A: Introduction: Bovine pancreatic trypsin inhibitor (BPTI) binds to trypsin and prevents peptide…
Q: a. Is the disaccharide below a non-reducing sugar? yes or no b. The glycosidic linkage in the…
A: Carbohydrates are composed of carbon, oxygen, and hydrogen which are connected by the…
Q: What is pH
A: It measures how acidic or alkaline the given solution is. It is very important to maintain the…
Q: What is the purpose of the low temperature step in the PCR reaction? a. To allow DNA polymerase to…
A: The denaturation step of PCR is optimized for high temperatures. The annealing step in PCR is…
Q: Match the following methods of Analysis v Fractional analysis, methylation, and periodate oxidation…
A: The Biochemical analysis techniques are a set of methods, procedures and assays. This enables…
Q: In your own understanding, what do you think is/are the reason why most of the clinical features of…
A: Deficiency disease is described as a type of disease that is majorly caused due to the lack of some…
Q: The fact that some eukaryotic rRNAs are self-splicing indicates that RNA structures are highly…
A: Introns are non-coding sequences, which are removed during the process of splicing. Splicing is…
Q: Which of the following is NOT a major source of protein? A. fish B. Milk C. Egg D. Rice
A: Introduction: Proteins are organic substances and polymers of amino acids. The elements present in…
Q: ОРОЗ CH2 OH ОН ОН ÓH
A: In the given molecule a phosphate group is attached to a monosaccharide at the 6th carbon.…
Q: Based on the given picture, answer numbers 1-3. Also, answer number 4. 1. What are the two…
A: Hi! Thank you for the question. We are authorized to answer three subparts at a time, please repost…
Q: In addition to cleaving peplides, chymotrypsin can akso catalyze the hydrołysis of certain small…
A: Hi! Thank you for the question. We are authorized to answer one question at a time, since you have…
Q: If we take a cholesterol test and the test results are high or low, what are the reasons that led to…
A: Cholesterol is a waxy substance found in your blood. The body needs cholesterol to build healthy…
Q: 97) In order for a retrovirus to be infectious a. The p25 protein is cleaved by the protease enzyme…
A: Introduction: Retroviruses are a family of viruses that are grouped together based on how it is…
Q: Which of the following molecules is NOT an amphipathic? phosphatidyl choline cholesterol…
A: Amphiphatic are the molecules which contain both hydrophobic as well as hydrophilic in their…
Q: Match the following methods of Anlaysis v Fractional analysis, methylation, and periodate oxidation…
A: Different chemical, physical and enzymatic methods in several applications of biological, chemical…
Q: The most regulated enzyme in glycolysis is a Hexokinase b G3P Dehydrogenase c Pyruvate…
A: Glycolysis is a metabolic pathway during which glucose molecule splits into pyruvate molecules with…
Q: TRUE or FALSE: Fatty acids are synthesized thru a chain of elongation that starts from Acetyl-CoA as…
A: The majority of fatty acids the human body needs are obtained through food. There is a de novo…
Q: 3. Recombinant protein is produced by a genetically engineered strain of Escherichia coli during…
A: Disulfide-bonded proteins primarily mature in the oxidative environment of the eukaryotic…
Q: Explain how do you prepare a 25-mL solution of 1 mg/mL cholesterol stock?
A: Given Values: Volume = 25 ml Concentration = 1 mg/ml
Q: If an amino acid weighs 100 Da, and the protein contains 70 amino acids, what is the weight of the…
A: Amino acids are the building blocks of proteins. Multiple amino acid units are joined together to…
Q: 4. Show exactly which peptide bonds you would expect trypsin to cleave if you set a digest with the…
A: Enzymes are protein molecules that increase the rate of biochemical reactions. Trypsin is an enzyme…
Q: 2. The two diagrams to the right il- lustrate plots of steady-state ki- netic studies to…
A: Phosphofructokinase adds a phosphoryl group from ATP to Fructose 6 phosphate (F6P) to yield Fructose…
Q: What products are formed when the stachyose (refer to the photo) is hydrolyzed? sorbose, 2…
A: Stachyose occurs naturally in numerous vegetables and plants, such as green beans, soybeans, and…
Q: Which of the following lipids is NOT found in biological membranes? glycolipids…
A: Glycolipids are substances expressed on the surface of cellular membrane. Glycolipids are lipids…
Q: What amino acid side chains can be modified by methyl groups? What is unusual about methyl group…
A: What amino acid side chains can be modified by methyl groups? Answer: Methylation is a process of…
Q: Gel Filtration Chromatography Affinity Chromatography SDS-PAGE
A: The branch of biology completely focuses on studying the various biological life processes at…
Q: The picture shown depicts what type of compound binding to an enzyme? A) A competitive inhibitor B)…
A: Regulatory enzymes show increased or decreased catalytic activity in response to specific types of…
Step by step
Solved in 2 steps
- TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT Write the amino acid sequence of the protein that would be formed by translating this plece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids, Use the abbrevlation of the amino adid exactly as Itswritten in the table (including the appropriate capltalizations For example it your answer for amino acid 1 is"Methionine" you would write MET in the box (not Met or met) Second Later UUU UUUC Phe UCU UAU Ser UAC UAA UAG Tyr UGU Cys U Leu UCA ucG UGC Stop uGA Beop UUG Step UGG Trp G Cuu C cuC CUA CUG CU Leu Coc CCA CG CAU Pro cGu CAC CAA CAG His CGC Arg CGA CGG 1st 3rd letter AUU A AUG AUA AUG ACU le AAU AAC AGU ACC Asn Ser U leBer ACC ACA Mct ACG The AAA AAG ACA Lys AGG Arg acu Val GCC GCA GCG GAU GAC GAA GAG GOU GGC GGA GGG Arp G GUC GUA GUG Ala Gly Glu Seovence of the protein, 1st amino acid. 2nd arnino acid: 3rd amino acid: 4th amino acid Sth amino acid: 6th amino acid: 7th amino…wol for Frayon Elolog - Meet - cha-gX-m sc Jupiter Ed G Which orgerell= A sample of DNA is collected from an organism. It is analyzed and determined that 20% of the DNA is made up of the base adenine. Based on this information, which of the following correctly lists the amounts of the three. remaining bases for this sample? 10% cytosine, 30% thymine, 40% guanine O 20% cytosine, 20% thymine, 20% guanine 30% cytosine, 30% thymine, 20% guanine 30% cytosine, 20% thymine, 30% guanine p. 5 of 31Table I CACGT A GA CTGAGG ACTC CACGTAGACTGAG G ACAC Wild-type beta-globin gene fragment Sickle-cell beta-globin gene fragment > Circle the mutation in DNA of the sickle-cell beta-globin gene fragment Compare fragments of DNA the wild-type and mutant beta-globin genes in the Table I above, what are the similarities and differences you observe?
- EcoRI --- 5' G - AATTC 3' 5' AGAATTCCGACGTATTAGAATTCTTAT CCGCCGCCGGAATTCT CATCA 3' 3' TCTTAAGGCTGCATAATCTTAAGAATAGGCGGCGGCCTTAAGAGTAGT 5' Number of pieces of DNA , and type of fragment .Oh G A Stocking Stuffers | Artifact Uprising This is the sequence of a piece of DNA. TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT 1st letter Write the amino acid sequence of the protein that would be formed by translating this piece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids. Use the abbreviation of the amino acid exactly as it is written in the table (including the appropriate capitalizations) For example, if your answer for amino acid 1 is "Methionine" you would write MET in the box (not Met or met) U UUC Phe UCU UCC UUA | UUG U AUU A AUC AUA AUG GUU G GUC GUA GUG Leu CUU CCU C CUC Leu CCC Pro CUA CUG 1st amino acid: UCA UCG lle CCA CCG ACU ACC ACA Met ACG GCU Val GCC GCA GCG Sequence of the protein: C Second Letter A Ser Thr Ala UAU UAC Tyr UAA Stop learn.maricopa.edu CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG 1 UAG Stop UGG Trp G His Gin Lys Asp Asn AGU AGC AGA AGG Glu CGU CGC UGU UGC UGA Stop A CGA CGG G |…A Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine Threonine
- Numbering the fragments left by cutting the DNA with BAM HI from left to right, which fragment will travel the furthest? BAM HI: GGATCC CCTAGG AATCGGATCCATTTGGACTAAAGGACCCGGATTGGATCCAGGGCCTTTAGTACC TTAGCCTAGGTAAACCTGATTTCCTGGGCCTAACCTAGGTCCCGGAAATCATGG O 3 O 2 4. 1.7:07 1 How Mutations Occur (Developing) Question O Practice It! /// A Select the statement(s) that accurately describe the function of DNA polymerase and the types of mutations that may occur. O Point mutations occur when a single nitrogenous base is substituted. Frameshift mutations occur when a nitrogenous base is inserted or deleted. start d le O Point mutations are less serious than frameshift mutations, as only a single base pair is affected. DNA has rare mutations during replication because DNA polymerase functions to build and repair errors in nitrogen base pairings of A-G and T-C. 3 Pro O DNA has rare mutations during replication because DNA polymerase functions to build and repair errors in nitrogen base pairings of A-T and G-C. O Point mutations occur when a nitrogenous base is inserted or deleted. Frameshift mutations occur when a single nitrogenous based is substituted. B.McKenzie - Uncontrolled Cell Growth B.McKenzie - Uncontrolled Cell Growth B.McKenzie - Uncontrolled…smolA eno DNA -- THE DOUBLE HELIX (modified from The Biology Corner - Worksheets and Lessons) The nucleus is a small spherical, dense body in a cell. It is called the "control center" because it controls all the activities of the cell. Chromosomes, found in the nucleus, are microscopic, threadlike strands composed of the chemical DNA (short for deoxyribonucleic acid). Chromosomes are composed of genes, which is a segment of DNA that codes for a particular protein which in turn codes for a trait. It is commonly referred to as the gene for baldness or the gene for blue eyes. In 1953, James Watson and Francis Crick established the structure of DNA. The shape of DNA is a double helix, which is like a twisted ladder. The sides of the ladder are made of alternating sugar and phosphate molecules. The sugar is deoxyribose. Color all the phosphates red (labeled with a "p"). Color all the deoxyriboses blue (labeled with a "D"). The rungs of the ladder are pairs of 4 types of nitrogen bases. The…
- Demuestra lo que sabes del vo X ure.com/courses/57129/quizzes/206819/take Question I8 1 pts 3.7- Chargaff's Rule & The Hayflick Limit In 1950, Erwin Chargaff analyzed the base pair composition of DNA. He discovered that... % Adenine = % Thymine % Cytosine = % Guanine Meaning... There are equal amounts of Adenine and Thymine and equal amounts of Cytosine and Guanine in any given DNA sample. Question: Which of these statements is TRUE if there is 40% Guanine in a strand of DNA? There is 20% Adenine O There is 15% Thymine O There is 10% Cytocine O There is 10% AdenineIII. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…āiglho älimill JS - alimi 9 Which of the following is found in a molecule of DNA? 1 ribose phosphate groups deoxyribose nitrogneous bases Show