Answered: Write the Structure Activity…

Science

Biochemistry

Write the Structure Activity Relationship ( SAR) of Captopril ?

Principles Of Radiographic Imaging: An Art And A Science

6th Edition

ISBN:9781337711067

Author:Richard R. Carlton, Arlene M. Adler, Vesna Balac

Publisher:Richard R. Carlton, Arlene M. Adler, Vesna Balac

Chapter24: Informatics In Medical Imaging

Section: Chapter Questions

Problem 3RQ

See similar textbooks

Related questions

Q: Sketch out a structure of tyrosyl-glycyl-lysine at a pH of 13

A: Amino acids are the monomeric unit of polypeptides that give proteins. There are 20 amino acids that…

Q: Explain the Titrimetric profile of Lysine in figure 2

A: The isoelectric point is the pH at which any amino acid or protein has no net charge and thus will…

Q: Dihedral angles of Phe165 of 4KW4 betasheet values are consistent with what is expected from the…

A: phi and psi angles are known as dihedral angles. They dictate the peptide conformation. phi…

Q: Draw Glu-His-Trp-Ser-Gly-Leu-Arg-Pro-Gly peptide. What is the net charge of this peptide at pH 3, 8…

A: polypeptides are made up of amino acids that are joined together by peptide bonds (covalent in…

Q: Which nuclear isotope used in protein NMR spectroscopy is the most sensitive to detect? Briefly…

A: NMR Spectroscopy is used to study the structure and composition of biomolecules like proteins. Here…

Q: A mixture of Aspartic Acid (pl 2.98), Histidine (pl 7.59), Lysine (pl 9.74), Phenylalanine (pl 5.48)…

A: In chromatography, we've got a go with the flow coming out of a column, when we inject a substance…

Q: Write down the Gly-Asp-Ala tripeptide and find its isoelectric point

A: Amino acids are biomolecules that are made up of two functional groups, these are an amino group and…

Q: Please draw the given peptide and calculate the net charge at pH 1, 4, 8 and 12. GRNVGHEWA

A: Peptides are short chains of a range of two to fifty amino acids, connected by peptide bonds. Chains…

Q: Provide the molecular interpretation of the hydrophobic interaction ?

A: Hydrophobes (water-hating) are molecules that have low or very-low solubility in water. When…

Q: Calculate and draw a line graph of the pI of the following: a. Histidine b. Arginine c. Aspartic…

A: pI: the pH at which an amino acid exits as a zwitter ion is called iso electric point. It is…

Q: Indicate all the possible sequences for a tripeptide containing alanine, glutamine, and methionine;…

A: A peptide is the sequence of amino acids that are joined through the formation of peptide bond in…

Q: What is the formation of 2 tripeptides of glycine? Where is the location of the peptide bonds and…

A: Proteins are polymers of amino acids. Amino acids sequence in a protein is guided by the nitrogen…

Q: Draw the arrow-pushing mechanism for this knowing that histidine amino acid residue acts as a…

Q: Match the following protein descriptions with the method that is best for determining the structure.…

A: The protein 3-D structure can be determined using techniques like NMR, X-ray crystallography, and…

Q: Find the isoelectric point by typing Gly-Asp-Ala tripeptide.

A: A tripeptide is a peptide derived from three amino acids joined by two or sometimes three peptide…

Q: a. d(pAACGTCTC) b. pGUAACUGC

A: Oligonucleotides are the short DNA or Rna molecules known as oligomers.

Q: You are studying the toxic protein called ectatomin, a major component of ant venom (specifically…

A: Proteins contain amino acids. They are linked to each other by peptide bonds. The amino acid such as…

Q: *H3N -Č-H CH2 он Tyrosine Draw the structures of tyrosine as different pH values. Please refer to…

A: Ionization state of any amino acid is decided by its pKa value and pH of solution. pKa and pH both…

Q: What is the maximum number of possible intra-peptide disulfide bonds for any given peptide form?

A: The side chains of Cysteine residues in proteins undergo oxidation to form disulfide linkages.

Q: If guanine, found in the first base triplet, is removed, explain how this would affect the structure…

A: The bases in the template strand of the DNA decide the bases in the strand of mRNA or messenger RNA…

Q: How many functional groups does the peptide MDFGRKCDE have that can be titrated? 6. 8. 7 O O O O

A: In organic molecules, the functional groups., which refer to the specific group of atoms presenting…

Q: What is the optimum pH to separate a mixture of lysine, arginine, and cysteine using…

A: Amino acid is a organic molecule made up of amino group (NH2 - basic), carboxyl group (COOH -…

Q: Please Write the Structure Activity Relationship (SAR) of Losartan?

A: -Losartan is generally used to prevent heart attack or we can say that it's very useful in…

Q: Draw the structure of the tetrapeptide 1. H,N - Lys - Ser-Asp- Ala - COOH Assign IUPAC names to each…

A: Protein or polypeptide is a sequence of amino acids in which the amino-terminal of one amino acid is…

Q: whereas protein B does not absorb at 340 nm. What absorbance will be observed when light at 340 nm…

A: Given, ε (extinction coefficient) = 6440 M-1 cm-1 l (path length) = 5 mm = 0.5 cm c (concentration)…

Q: Calculate and compare the approximate MW of a protein with 682 amino acid residues in a single…

A: All the amino acids have an R group, H, COOH, and NH3.

Q: For determining the crystal structure, a short sequence of histidine residues is sometimes attached…

A: A polyhistidine tag is an amino acid motif in proteins that typically consists of at least six…

Q: Please provide a chromatography technique to isolate the protein A from the mixture containing…

A: Chromatography is the technique used for the separation of molecules or analytes from the mixture by…

Q: What kind of information is stored in protein three-dimensional structure. Why 3D structure…

A: Amino acids Proteins are the polymers of nitrogenous compounds called amino acids. Each amino acid…

Q: Name the following biomolecules. In the case of peptides, alos provide 3 - letter codes.

A: a. Peptide is a short sequence of amino acid residues, which is joined by a peptide bond. b. Lipids…

Q: list the amino acids that will carry a net charge at pH 7 within a protein. What is the charge at pH…

A: Note : Hi ! Thank you for the question. We are authorized to answer one question at a time. Since…

Q: For each denaturing agent, explain the changes that you observe in terms of change in protein…

A: Protein denaturation is one of the processes that disrupts a protein's stability and structure.…

Q: There are a total of six different amino acid sequences for a tripeptide containing one molecule…

A: Any peptide that is obtained by a set of three amino acids joined together is known as a tripeptide.…

Q: Given this: Protein Isoelectric pH Molecular weight (kDa) Ovalbumin 4.6 45 Insulin 5.4 5.7…

A: The isoelectric pH and molecular weight (kDa) is given for proteins i.e. ovalbumin, insulin,…

Q: draw the primary structure of the polypeptide at physiological pH range of 7.35-7.45 and put each…

A: The polypeptide of a protein is composed of different amino acids that are joined together through…

Q: Consider Isoleucine, structures are provided for the 4 stereoisomers, complete the table by…

A: Amino acids are present in the body and use for the synthesis of proteins. Isoleucine is an α-amino…

Q: Sketch resonance structures for the peptide group.

A: Peptides are short-chain made up of amino acids. The amino acids are linked together through peptide…

Q: Write the chemical structure of peptide containing the following amino acid PRO-SER-GLY-LEU

A: Proteins are one of the most important compounds in the cells. Proteins are involved in all cell…

Q: GTTTTCACTGGCGAGCGTCATCTTCCTACT 10. Generate a secondary structure prediction for one identified…

Q: How do you draw the resolution to the double Holliday junction? Each step explained in detail.

A: Double Holliday junction is a structure that is formed at the instant when the genetic…

Q: Write the Structure Activity Relationship (SAR) of Miscellaneous?

A: It is very important to determine the biological activity of drugs, medicines, vaccines and any…

Q: Describe the principal biophysical and biochemical techniques used to study tertiary and quaternary…

A: The chain of amino acids where each amino acid is linked to others via a peptide bond is known as a…

Q: After staining an SDS-PAGE gel with Coomassie Blue G-250, the protein bands are visualized by…

A: Protein purification is the process in which a protein or a number of proteins are separated or…

Q: Which of the peptide sequences below best matches the hydropathy plot shown? L 10 Residue Number 4 2…

A: Hydrophobicity plot analyzes the amount of the hydrophobicity and the hydrophilicity that is present…

Q: Write the Structure Activity Relationship (SAR) of Nifedipine ? Please write at your own words.

A: Nifedipine is a drug used in treatment of hypertension .It comes under the category of calcium…

Q: The following illustrations show examples of the secondary, supersecondary (motifs), tertiary, or…

A: Proteins are an important biomolecule for all living organisms as they are required to perform a…

Q: . Explain in detail the Shine-Dalgarno sequence.

A: A ribosomal binding site (RBS) is a nucleotide sequence upstream of an mRNA transcript's start codon…

Q: Draw the structure of the following 1.Alanylaspartylglutamyltryrosin 2. Tetrapeptide

A: Proteins are made of α-amino acids. The α-amino acids contain a central carbon atom called the…

Concept explainers

Metabolic pathways

Metabolism is defined as the group of life-supporting, enzyme-mediated chemical reactions in organisms. A metabolic pathway is a set of these chemical reactions that involve anabolism (synthesis of complex biomolecules) and catabolism (breakdown of biomolecules into small molecules) that occur inside a cell. Metabolites are the reacting substances, products, and intermediate substances of an enzymatic process that are altered by a series of chemical events catalyzed by enzymes.

Question

Write the Structure Activity Relationship ( SAR) of Captopril ? Please write at your own words.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps with 1 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.

Similar questions

Dichotomous key:a. Convert the following dichotomous key into the flowchart version as described in Fig. 10.5 of your text. please refer to attached photo.
Sequence: CCACCTGTACCCGGACACACCCTGGTGTCC What human disease has been connected to this gene? Calculate molecular weight (kiloDalton, kD) and calculated pI (the pH where the protein carries no net electrical charge) of the protein.
Give typed solution not written
What is the difference between the vibratory movement of the translation movement?
Please help me with part one question 3 Thank you PDF link https://www.cusd80.com/cms/lib/AZ01001175/Centricity/Domain/8922/eofad.pdf
Use the following DNA sequence, and write the resulting messenger RNA sequence TACTTTGAATGCGGCCGTATC?
These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV
Sequence: CCACCTGTACCCGGACACACCCTGGTGTCC Are there homologues for the identified gene in other systems? Identify one homologue in a invertebrate system (if there is none, provide a vertebrate homologue). What is the function (e.g. transcriptional regulation, transmembrane signaling, kinase, protease etc.) of the protein(s) encoded by the gene.
MAP= CO x TPR / 80 I don't understand the value of TPR how do I get this number?
Consider the following two nonhomologous wildtype chromosomes, where letters or numbers represent genes, the "-" represents the centromere of each chromosome, and chromosomes are shown on separate lines. ABCDE-FGHIJK 123-45678 Identify the type of rearrangement shown in each of the following (A-C) and then identify whether it is balanced or unbalanced. Assume that the individual is diploid and heterozygous for the rearrangement. A. • ABCDE-FGHIJKGH 123-45678 Rearrangement: [Select] • Balanced or Unbalanced: [Select] B. • ABCDGF-EHIJK 123-45678 Rearrangement ✓ [Select] • Balanced or Un pericentric inversion Robertsonian translocation deletion tandem duplicate paracentric inversion C. reciprocal translocation ABCDE dispersed duplicate nonreciprocal translocation 123-45
Protein analysis by gel electrophoresis a). Using the gel image provided to calculate the electrophoretic relative mobility as a ratio of the distance of protein migration to the distance of the tracking dye migration (See Appendix B). If your dye front is not visible, measure the mobility relative to the bottom edge of the resolving gel. Include a labeled print-out of your gel image with your report. b). Plot log MW of the protein markers and commercial myoglobin vs. mobility. Determine the molecular weight of myoglobin obtained after the final purification step (Sample E) from the equation of the line. Submit a copy of your graph along with the gel image. c). Compare your sample E and commercial myoglobin with the ladder. Summary your results. order of sample (left to right) is : A B C D blank E blank Commercial Myoglobin Molecular Ladder
Pls help ASAP. Pls answer all the questions. Pls look at both images to refer.