Homework Help is Here – Start Your Trial Now!
Science
Biochemistry
Part F - Identifying conserved residues from the BLAST alignment If an amino acid is found at the exact same location in the alignment of two homologous proteins, that amino acid is said to be "absolutely conserved." An amino acid type can also be conserved at a given position. Using the BLAST sequence alignment above, sort aligned residues into the appropriate categories. Drag the appropriate alignments to their respective bins. ► View Available Hint(s) I→L Q→E V→Q D→S Absolutely conserved W F T→M D→N Conserved by type N→G K→K A→E Not conserved Reset Help

Part F - Identifying conserved residues from the BLAST alignment If an amino acid is found at the exact same location in the alignment of two homologous proteins, that amino acid is said to be "absolutely conserved." An amino acid type can also be conserved at a given position. Using the BLAST sequence alignment above, sort aligned residues into the appropriate categories. Drag the appropriate alignments to their respective bins. ► View Available Hint(s) I→L Q→E V→Q D→S Absolutely conserved W F T→M D→N Conserved by type N→G K→K A→E Not conserved Reset Help

Biochemistry
Biochemistry
9th Edition
ISBN:9781319114671
Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.
Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.
Chapter1: Biochemistry: An Evolving Science
Section: Chapter Questions
Problem 1P
See similar textbooks
icon
Related questions
Question
### Full Amino Acid Sequence of FABP6 ``` MAFTGKFEMECEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDF TWSQHYSGGHTMTNKFTVGKECNIQTMGKTFKATVQMEGGKLVVN FPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA ``` ### Sequence Analysis After determining the full amino acid sequence of FABP6, a BLAST search was conducted against the Protein Data Bank (PDB) to find similar structures. One structure was found to be 59% identical to the FABP6 sequence. The alignment of your protein (FABP6) is shown in blue, while the homologous structure (3ELX) is displayed in red. **BLAST Alignment Results:** - **Expect Score:** \(4 \times 10^{-42}\) - **Identities:** 69/116 (50%) - **Positives:** 88/116 (75%) #### Sequence Alignment ``` 3ELX: 5 AFNGKWETE...VTEIVQNGDDFTWTQYYPNNHVMT 64 AF GK++E EC++ Y+ F KL+GI DVI K R+FK+VTE+ Q+G D F TW+Q+Y H MT FABP6: 2 AFTGKFMEC...TVEQQDGQDFTWSQHYSGGHTMT 61 3ELX: 65 NKF IVGKE...ISEIGGKLVE...VETSTASG 120 NKF VGKEC++T+ G FK V MEGKL+ +FP Y QT+EI G KLVE ST G FABP6: 62 NKFTVGKE...GKT FKATVQ...VEVSTIGG 117 ``` ### Alignment Explanation - **Identical Amino Acids:** Shown in black. - **Similar, Non-identical Amino Acids:** Noted by a "+" symbol. The sequences are aligned to show overall gaps, indicating differences in the sequences but with substantial similarities. This alignment can help in understanding the functional and structural similarities between the two protein sequences,
Transcribed Image Text:### Full Amino Acid Sequence of FABP6 ``` MAFTGKFEMECEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDF TWSQHYSGGHTMTNKFTVGKECNIQTMGKTFKATVQMEGGKLVVN FPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA ``` ### Sequence Analysis After determining the full amino acid sequence of FABP6, a BLAST search was conducted against the Protein Data Bank (PDB) to find similar structures. One structure was found to be 59% identical to the FABP6 sequence. The alignment of your protein (FABP6) is shown in blue, while the homologous structure (3ELX) is displayed in red. **BLAST Alignment Results:** - **Expect Score:** \(4 \times 10^{-42}\) - **Identities:** 69/116 (50%) - **Positives:** 88/116 (75%) #### Sequence Alignment ``` 3ELX: 5 AFNGKWETE...VTEIVQNGDDFTWTQYYPNNHVMT 64 AF GK++E EC++ Y+ F KL+GI DVI K R+FK+VTE+ Q+G D F TW+Q+Y H MT FABP6: 2 AFTGKFMEC...TVEQQDGQDFTWSQHYSGGHTMT 61 3ELX: 65 NKF IVGKE...ISEIGGKLVE...VETSTASG 120 NKF VGKEC++T+ G FK V MEGKL+ +FP Y QT+EI G KLVE ST G FABP6: 62 NKFTVGKE...GKT FKATVQ...VEVSTIGG 117 ``` ### Alignment Explanation - **Identical Amino Acids:** Shown in black. - **Similar, Non-identical Amino Acids:** Noted by a "+" symbol. The sequences are aligned to show overall gaps, indicating differences in the sequences but with substantial similarities. This alignment can help in understanding the functional and structural similarities between the two protein sequences,
**Part F - Identifying conserved residues from the BLAST alignment** If an amino acid is found at the exact same location in the alignment of two homologous proteins, that amino acid is said to be “absolutely conserved.” An amino acid type can also be conserved at a given position. Using the BLAST sequence alignment above, sort aligned residues into the appropriate categories. **Drag the appropriate alignments to their respective bins.** - **Amino Acid Alignments:** - I → L - Q → E - W → F - N → G - V → Q - T → M - K → K - D → S - D → N - A → E **Bins:** - Absolutely conserved - Conserved by type - Not conserved **Interactive Elements:** - Reset Button - Help Button _Note: This section of the webpage involves an interactive sorting activity where users classify the conservation of amino acid residues based on BLAST alignment data._
Transcribed Image Text:**Part F - Identifying conserved residues from the BLAST alignment** If an amino acid is found at the exact same location in the alignment of two homologous proteins, that amino acid is said to be “absolutely conserved.” An amino acid type can also be conserved at a given position. Using the BLAST sequence alignment above, sort aligned residues into the appropriate categories. **Drag the appropriate alignments to their respective bins.** - **Amino Acid Alignments:** - I → L - Q → E - W → F - N → G - V → Q - T → M - K → K - D → S - D → N - A → E **Bins:** - Absolutely conserved - Conserved by type - Not conserved **Interactive Elements:** - Reset Button - Help Button _Note: This section of the webpage involves an interactive sorting activity where users classify the conservation of amino acid residues based on BLAST alignment data._
Expert Solution
trending now

Trending now

This is a popular solution!

steps

Step by step

Solved in 4 steps with 17 images

SEE SOLUTIONCheck out a sample Q&A here
Blurred answer
Similar questions
Recommended textbooks for you
Biochemistry
Biochemistry
Biochemistry
ISBN:
9781319114671
Author:
Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.
Publisher:
W. H. Freeman
Lehninger Principles of Biochemistry
Lehninger Principles of Biochemistry
Biochemistry
ISBN:
9781464126116
Author:
David L. Nelson, Michael M. Cox
Publisher:
W. H. Freeman
Fundamentals of Biochemistry: Life at the Molecul…
Fundamentals of Biochemistry: Life at the Molecul…
Biochemistry
ISBN:
9781118918401
Author:
Donald Voet, Judith G. Voet, Charlotte W. Pratt
Publisher:
WILEY
Biochemistry
Biochemistry
Biochemistry
ISBN:
9781305961135
Author:
Mary K. Campbell, Shawn O. Farrell, Owen M. McDougal
Publisher:
Cengage Learning
Biochemistry
Biochemistry
Biochemistry
ISBN:
9781305577206
Author:
Reginald H. Garrett, Charles M. Grisham
Publisher:
Cengage Learning
Fundamentals of General, Organic, and Biological …
Fundamentals of General, Organic, and Biological …
Biochemistry
ISBN:
9780134015187
Author:
John E. McMurry, David S. Ballantine, Carl A. Hoeger, Virginia E. Peterson
Publisher:
PEARSON
SEE MORE TEXTBOOKS