Q: hat cell parts are visible
A: Bacteria are single-celled microorganisms. These are not visible to the naked eyes. They are found…
Q: 16. Bacterial cell wall membrane includes all EXCEPT ( Mark both answers ) Group of answer choices…
A: Since you've asked multiple questions, we are only answering the first three questions for you. If…
Q: Microbiology the phrases from column (A) with hrases in column (B
A: AUG - Methionine Haploid - Bacterial chromosome Restriction enzymes - Beta lactum drug AGC - Codon…
Q: Which peptide is the least likely to be made on the ribosome and why?
A: Ribosomes are composed of two subunits, the large and the small subunit, both of which consist of…
Q: Figure 9.2 Using Figure 9.2, match the following: 42) I band. 43) H zone. 44) A band. 45) Z disc.…
A: A sarcomere is a Z-line segment that connects two adjacent Z-lines (or Z-discs). The Z-line (from…
Q: A diploid organism with a 45,000-kb haploid genome contains 21% G residues. Calculate the number of…
A: According to Chargaff's rules, DNA from each cell of any organism should contain a 1:1 ratio (base…
Q: Draw the virions that would infect a new bacteria. What kind of genetic material will each newly…
A: Viruses are considered nonliving things because they are not made up of cells and cannot replicate…
Q: ed labelled 18,19,20.
A: The scapula is the bone that links the humerus (bone of the upper arm) with the clavicle…
Q: Staining procedure Dye (Basic or acidic) Charge of the chromophore/ colored ion Charge of the target…
A: Staining methods are used to improve and enhance the sample contrast for it to be studied under a…
Q: F plasmid F’ plasmid (and how is it formed) Hfr cell (and how is it formed)
A: Plasmids are the extrachromosomal material that exist apart from the main chromosome in a bacterial…
Q: The experiment shown above was designed by Row A B. C D. i Hershey & Chase Hershey & Chase Meselson…
A: In the year 1952, two geneticists- Alfred Hershey and Martha Chase, conducted series of experiments…
Q: Acid fast staining Endospore staining simple stain
A: Staining is a method in which images of specimens enhanced at microscopic level. It is commonly used…
Q: Pipetting 1. Explain why a micropipettor is an important instrument in biochemistry labs. 2.…
A: Since you have asked multiple question, we will solve the first question for you. If you want any…
Q: asc DF eas fill Which of the following is NOT a step in the replication of a retrovirus? A diagram…
A: RNA is the genetic material for viruses called retroviruses. They are members of the retrovirus…
Q: is the encysted larva of the beef tapeworm called? a. Cysticerci b. Miracidia c. Cercaria d.…
A: Explanation: 1) Which of the following correctly describes bacteria? Answer: c)arrangements are…
Q: ich of the following is not correct regarding genetic material transfer? When virulence plasmids…
A: Transposons or jumping genes are sequence which are present indide dna and does not code any…
Q: Hello, I want 2-page report on (Cell Biology) (ATP)
A: Understanding ATP’s structure, how it is delivered, and how it capacities can give significant…
Q: 1. Identify the 2 CORRECT statements from the following. Mark both answers Group of answer choices…
A: The genetic information of one bacterium is transferred to other bacteria through mechanisms called…
Q: pH of a pond is measured as 4.0. What is the hydrogen ion and hydroxide 1on concentration of the…
A: pH is a scale used to determine the acidity or basicity of an aqueous solution by measuring the…
Q: 10KB 3Kb IKb 0.5Kb FA IKB DNA Ladder Negative Control Positive Control Phage DNA+ B Primers
A: Polymerase chain reaction (PCR) is a molecular biology technique that is used to make multiple…
Q: What mediates the assembly when new viruses are being assembled at the point marked IV in the…
A: One of the most important step in a viral life cycle is the viral assembly. It is a dynamic process…
Q: I E I : Shaded individuals have a rare genetic disorder. THIS IS NOT 1. Is the disorder dominant or…
A: Ans: Pedigree analysis: The analysis is used to identify the genotypes of the individuals. It also…
Q: i.) Fill in the table for each of the E. coli: (0) = No Activity (+) = Basal Activity and (+++) =…
A: Hi! Thanks for your question. As you have posted multiple questions and have not mentioned which…
Q: A. Why did Lilly use acid fast staining to diagnose the presence of Mycobacterium tuberculosis…
A: Since you have asked multiple questions, we will solve the first question for you. If you want any…
Q: Hershey and Chase added isotopes to bacteriophage viruses to label the proteins and DNA of the…
A: DNA is the organic molecule that carries information from one generation to another. Several…
Q: draw structure of plasmid
A: The plasmid is the extrachromosomal deoxyribonucleic acid (DNA) that is present with the bacterial…
Q: Acne Prone Skin
A: In case of acne prone skin it is always better to double cleanse face in order to remove all the…
Q: Students subjected three samples of five different molecules to gel electrophoresis as shown in…
A: Gel electrophoresis is a technique in molecular biology in which different samples (DNA, RNA or…
Q: Sticky end ligation is generally preferred over blunt end ligation. Discuss one (1) scenario where…
A: Sticky end and blunt and ligation.
Q: UUU UUC UUA UUG UCU UCC UCA UCG UAU UAC UAA Stop UGA Stop UAG Skop Phe UGU UGC Ser UGG Trp CUU CUC…
A:
Q: True of False 9) Gels are read from left to right. Answer: 10) Functional segments of genes…
A: Gel electrophoresis is a technique which is used to separate DNA fragments according to their size.…
Q: Include a maximum of 3 sentences, a brief description of their growth.
A: Bacteriophage --- Bacteriophage ( phages ) are viruses which infect the bacteria and kill the…
Q: Homogenize cells Centrifuge Heat-kill Recover IIIS filtrate IIIS cells spun to bottom of tube…
A: Transformation is the process by which microbes uptake genetic material from the surroundings and…
Q: What are the general rules in grams staining classification of bacteria?
A: In microbiology, Gram staining is the most widely utilised, vital, and widely used differential…
Q: Decoding a DNA Message 1. CGA ACT AGA TAA CCC TTA TAG AAA TAT ACA CGC TTG TGA AAC ATA ATC CGG CTG…
A: “Since you have asked multiple question, we will solve the first question for you. If youwant any…
Q: Viruses, although not considered to be alive, attack host cells and cause disease. The attack of a…
A: Deoxyribonucleic acid (DNA) stores the cell’s genetic information and is present in the nucleus of…
Q: PLS ANSWER ALL 1. Why were nuclei being unstained when you used eosin? 2. Aside from H&E, what…
A: Staining is a technique which is used to find different parts in the cell while observing under a…
![Match the specific parts/structures of the B-virus below
65 nm
B
Pin
(a) A T-even bacteriophage
[Choose ]
Choose
B.](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2Fa5dc3a87-b157-4e30-b893-3e4ccb91590d%2Fbb7a0582-b54f-4c56-9951-11c3db6363b0%2F3hguc6_processed.jpeg&w=3840&q=75)
![](/static/compass_v2/shared-icons/check-mark.png)
Step by step
Solved in 2 steps with 2 images
![Blurred answer](/static/compass_v2/solution-images/blurred-answer.jpg)
- The diagrams below represent nucleic acid genomic material and a finished product after the viral polymerase acted on the genomic material. Name the virus (either family, genus, or particular virus is acceptable) that these diagrams represent. A is B is C is Dis Genomic material Product + sense RNA A 5' VPB -sense RNA 3' VPg 5' -sense RNA 5' cap Derived from infected cell B 3' 5' AAAAA(A) 3 + sense RNA C + sense RNA -sense RNA +sense RNA 5' 3'answer doesn't have to be long i just need an explanation, thank you! The whole world right now is concerned (or they should be) about the appearance of new variants of SARS-CoV-2. Among other things, these variant viruses have mutations that change the amino acid sequence of the spike protein on the virus surface. While this is concerning, I would like to propose that there is a limit to how far these mutations can change the spike protein. Why can't there be an endless number of new mutations of this viral protein? How would these amino acid changes affect how the virus works?I need the answer as soon as possible
- "You wish to produce a subunit vaccine for a nonenveloped positive‐sense RNA virus that will stimulate the production of neutralizing antibodies in the person receiving it. Indicate which of the following viral proteins would be a logical candidate for such a subunit vaccine, and state a brief justification. a. Viral capsomer proteinb. Viral protein that is bound to the RNA genome inside of the virionc. Viral RNA polymerase"List three differences between the structure of HIV and the virus that causes influenza. For one of these differences, explain how the STRUCTURE is key to the FUNCTION of the virus.Can you please pick the right answer in each parentheses? The spike protein of SARS-CoV-2 is a carbohydrate-modified protein that ["bind the RNA genome of the virus", "", "is on the surface of the viral particle", ""] and plays a role in both ["replication of the viral genome", "recognition of host cell"] and ["packaging of viral genome for export", "fusion of viral envelope with host cell plasma membrane"] . Importantly, earlier work on spike proteins from other corona viruses showed that this molecule ["remarkable resistance to immune response", "shows remarkable conformational changes"] and only one of these served as a good antigen for vaccine development. A critical discovery in advancing the development of our current vaccines was determining what changes in the amino acid sequence would ["block degradation of the spike protein", "stabilize the conformation of the protein found on the viral particle"]. This…
- Can someone help me with my virology homework? Can you explain how to interpret these three figures?Research has found that 95% of the particles smaller or equal to the size of the COVID-19 virus will not penetrate through a mask. Based on molecular characteristics of surface molecules of the virus, why might this be?Coronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…
- A cell infected with lambda bacteriophage can follow one of two pathways: the lytic or lysogenic pathway. Describe the similarities and differences between the structure of cI and Cro, paying particular attention to the features that allow them to carry out their different functions.ss (-) RNA viral genome RNA polymerase RNA-dependent # O dsRNA O dsDNA. RNA-dependent RNA polymerase Coples (-) RNA strand transcription Copies (-) RNA strand. 80 ss (+) RNA S5 FA viral translation protein (+)RNA (viral mRNA) RNA-dependent RNA polymerase Copies (+) RNA strand. What type of virus is replicating in the picture? (-)ssRNA (+)ssRNA % C wil ss (-) RNA viral genome <(C 16 & 7Give typing answer with explanation and conclusion to all parts