Q: How do organisms with less complex systems such as those in protozoans are able to respond to…
A: Introduction: Stimuli is the a detectable change in the internal or external environment. which…
Q: What is meant by the term “intermediate fossil” when referring to the fossil record?
A: A fossil record is the history of life that is documented by fossils. An intermediate fossil is also…
Q: How long does it take for a bacterial culture with a generation time of 12 minutes to increase from…
A: The generation time is the time taken by a bacterial cell to divide. That means it indicates the…
Q: If the two populations in question 2 are determined to still be the same species, did allopatric…
A: The mechanism through which populations develop into different species is known as speciation. In…
Q: Which very specific synapse will produce the fastest propagation of an action potential? axosomatic…
A: Introduction A synapse is a junction where the axon of one neuron cell contacts another. Two types…
Q: "In a beaker containing 6% NaCl, you place a cell which contains 0.9% NaCl. NaCl doesn t cross the…
A: Introduction : Osmosis is a passive process and happens without any use of energy. It involves the…
Q: If you observe a selection coefficient of 0.025 against recessive homozygotes, what is the relative…
A: A "selection coefficient" quantitatively assesses one genotype's "relative fitness" to another. The…
Q: Caspases are involved in ___. Select one: a. protein dephosphorylation b. programmed cell death c.…
A: Ans- B) programmed cell death Programmed cell death is known as Apoptosis, which regulates the…
Q: What is the role of the mannose-6-phosphate (M6P) group? • What happens when M6P cannot be…
A: Mannose-6-phosphate is a molecule bound by lectin in the immune system. M6P is converted to fructose…
Q: The A and G compositions (mole percent) of one of the strands of a duplex DNA is A = 27 and G = 30.…
A: DNA is the molecule that carries the genetic information for an organism. It is basically made up…
Q: Describe primary and secondary active transport in detail
A: transportation in cell In biology, there are two mode of transport systems in the cell which…
Q: 1. Phenylethyl alcohol (PEA) agar is a selective media. Which of the following organisms should NOT…
A: The comprehensive research of microorganisms, whether they have one cell, many cells, or are…
Q: Which of the following will most likely contain a cofactor? Select one: a. an enzyme b. microRNA c.…
A: There are different biomolecules that are found within a living organism. These biomolecules…
Q: Codons 24 to 66 represent an intron. At what point in the process of protein synthesis are introns…
A: Transcribing DNA to RNA is the initial step in a long process that finally synthesizes functional…
Q: Time (hours) # of cells 1 2 64 0 ½ 4 6 10 19 32 110 10,000 30,000 80,000 170,000 106 Notes Egg is…
A: Introduction : The cell cycle (also known as cell division) is an organised series of cellular…
Q: A man with type B blood marries a woman with type A blood. They have the first child with blood type…
A: Introduction: Although blood groups refer to antigens on red blood cells, they are actually…
Q: Please do not copy here in Bartleby or in Google. QUESTIONS : 1. Why is it necessary to heat the lid…
A: Microbial culture refers to the growing and maintaining the pure cultures of bacteria and fungi.…
Q: Compare and contrast the operation of Optical microscopy and TEM in terms of Resolution
A: Resolution of microscope:- it is a ability to distinguish two tiny closer points or objects. It can…
Q: Which of the following processes and or mechanisms of evolution violate the assumptions of…
A: The Hardy-Weinberg principle states that a population’s allele and genotype frequencies will remain…
Q: Vicariance describes a fundamental process preventing gene flow which is part of Select one: a.…
A: Introduction Speciation is a process by which new plant or animal species is formed. Speciation is…
Q: The proteasome contains enzymes that cleave _________ bonds. Select one: a. peptide b. hydrogen…
A: The proteasome is a highly sophisticated protease complex designed to hydrolyze client proteins in a…
Q: Bacteria can evolve.
A: Bacteria are the unicellular prokaryotic organisms. They have a short life span and they divide…
Q: What is natural selection ?
A: Evolution is a continuous process that involves change, this change is necessary as it allows…
Q: Describe the theory of evolution, and name two ways that you can see it at work
A: It is the process of change in the heritable traits of a population over time. The organisms which…
Q: Compared to a protein with a low Km, a protein with a high Km possess ________ for the substrate.…
A: Enzymes are proteins and are basically catalyst that increases the rate of reaction. km is the…
Q: Describe the features of the fluid mosaic model of the cell membrane in detail
A: Please follow step 2 for detailed explanation.
Q: Which resulting population has more genetic diversity?
A: Evolution is the process of change in traits or characteristics of a population over many…
Q: Can simple technique be used to identify more than the morphological characteristics of…
A:
Q: Sickle cell anemia affects red blood cells by causing them to delivered efficiently to all parts of…
A: Red blood cells are present in the plasma of blood. The blood is a specialised connective tissue. It…
Q: Based on sequences A,B,C. Provide an anticodon sequence that would build this protein.
A: Codons are the sequences of nucleotides present on the mRNA strand, the tRNA (transfer RNA) brings…
Q: In endocrine signalling Only nearby cells are affected by the hormone Steroid based hormones are…
A: Signalling:- cell signalling may be categorised into various categories such as endocrine,…
Q: Which of the following is NOT a limitation of the current biological species concept? O Some…
A: According to biological species concept if two organisms can reproduce (mate) then they are…
Q: According to this phylogenetic tree, Callitris sulcata is sister to Select one: a. Callitris…
A: The majority of contemporary categorization schemes, or phylogenies, are based on the evolutionary…
Q: Please define the term closed circulatory system. Which animals have it, and what are its’…
A: The circulatory system is the system that transports blood, gases, nutrients, wastes, and lymph.
Q: Identify gene 1( bl, pr, vg) Identity gene 2 ( bl, pr, vg) Identify gene 3 ( bl, pr, vg)
A: The data is given for three point test cross. The three genes are involved in this case. These genes…
Q: What study design would you use to further investigate the association between the number of…
A: Please follow step 2 for detailed explanation.
Q: sIMILARITIES AND DIFFERENCES ecologist vs. environmentalist
A: Differences between ecologist and environmentalist: I) Ecologists are those who study ecology i.e.…
Q: 235) mGluRs are metabotropic receptors that are activated by the binding of the neurotransmitter…
A: glutamate receptors:- membrane have usually two types of glutamate receptors i.e. ionotropic and…
Q: The presence of a wattle and comb in a rooster is a result of: A. Ongoing presence of hormones in…
A: The wattle is a fleshy protuberance on the neck of many birds, especially turkeys, chickens and…
Q: Instructions Match the letters that describe the process with the numbers in the Venn Diagram. Each…
A: Here are the matches
Q: Selfing changes genotype frequencies within populations. A) True B) False
A: Introduction :- A population's genotype frequency is calculated by dividing the number of people…
Q: briefy explain 3 examples of pseudoscience that are related to evolution, or which discredits…
A: Introduction: The words "pseudo" and "science" are combined to form the definition of pseudoscience;…
Q: reduces
A: C.reduce ,unfolds. Due to their covalent nature disulfide bonds can have profound effects on the…
Q: 8. Explain how buffer systems are important in organisms. In the human body, bicarbonate and…
A: A buffer system is important for a living thing as it helps to maintain a constant chemical internal…
Q: A diploid species has 3 pairs of chromosomes in its somatic cells. In males, the first pair is large…
A: According to the position of centromere present chromosomes can be of different shapes such as…
Q: Which of the following is true about nucleosides and nucleotides? Choose all that apply. A…
A: Nucleosides and nucleotides are structural subunits of nucleic acids such as DNA and RNA.…
Q: Proteasome inhibition might lead to an immediate ________ Select one: a. increase in cysteines b.…
A: Proteasome works in conjunction with ubiquitin. Proteasomes are found in the cytosol, both free and…
Q: 2. List the 4 biologically importance molecules (carbohydrates/lipids/proteins/nucleic acids) and…
A: Introduction : Biomolecules are defined as the organic molecules present in a living cell which…
Q: 6. Vitamin B1: coenzyme form, functional groups, mechanism of action, biological role, sources,…
A: A vitamin is an organic molecule that is an essential micronutrient that an organism requires in…
Q: Phospholipids (Which is charged, what is the functional significance? Are they preferentially…
A: Phospholipids are biomolecules that are composed of glycerol, phosphate group, and lipids/ fatty…
Step by step
Solved in 2 steps
- Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatic tools for gene prediction, homology modelling and such are available free online. State the functions of CLUSTAL W, BLAST and GLIDE (Schrödinger).a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSPWithin genomics, genetic engineering and gene therapy are topics that are comparable. What do they have in common and what sets them apart?
- What novel applications or ethical considerations arise from the integration of genomics and personalized medicine?Describe the main technique for amplifying a segment of DNA (like the one you suspect is involved in Lee’s cancer) from a complex mixture of genomic DNA. Remember that the entire human genome sequence is known. (Hint: This is a technique that is commonly used by laboratories that do genetic testing and various other applications of molecular biology.)Which of the following are common types of datalanalysis that are used in bioinformatics. O DNA sequencing O RNA sequencing Epigenomic O Proteomic QUESTION 6 Order the following processes into the correct order for the generation and analysis of sequence data v Quality control analysis v Prepare sequencing libraries v Extraction of genetic material v Sequence and generate sequence data Alignment and/or variant calling Collection of cells for analysis
- Bioinformatics includes all of the following except (A) using computer programs to align DNA sequences. (B) using DNA technology to combine DNA from two different sources in a test tube. (C) developing computer-based tools for genome analysis. (D) using mathematical tools to make sense of biological systems.Give the similarities and differences of Genomics from Bioinformatics, and Proteomics from Transcriptomics and from Metabolomics.It has been suggested that it would make the study of human diseases easier if cloned transgenic animals were produced that carried faulty versions of human genes (e.g., the gene that causes cystic fibrosis). a. Why would such animals be useful in medical research? : b. What ethical questions are raised by the creation of such transgenic animals?