Concept explainers
(1)
To define:
The health-care associated infection.
Case summary:
In the given summary, an 85-year-old lady was hospitalized after she broke her hip by falling in the bathroom. She had a series of complications and her treatment is necessitated by a urinary catheter, a feeding tube, and an intensive antibiotic therapy. She acquired a life-threatening urinary tract infection along with the multi-drug resistant Enterococcus faecium. The patient lost her life even though she was treated with antimicrobial drugs including penicillin, metronidazole, ciprofloxacin, erythromycin, and vancomycin.
(2)
To determine:
What is the likely source of the patient’s infection.
Case summary:
In the given summary, an 85-year-old lady was hospitalized after she broke her hip by falling in the bathroom. She had a series of complications and her treatment is necessitated by a urinary catheter, a feeding tube, and an intensive antibiotic therapy. She acquired a life-threatening urinary tract infection along with the multi-drug resistant Enterococcus faecium. The patient lost her life even though she was treated with antimicrobial drugs including penicillin, metronidazole, ciprofloxacin, erythromycin, and vancomycin.
(3)
To determine:
List three ways through which E. faecium acquires drug resistant genes.
Case summary:
In the given summary, an 85-year-old lady was hospitalized after she broke her hip by falling in the bathroom. She had a series of complications and her treatment is necessitated by a urinary catheter, a feeding tube, and an intensive antibiotic therapy. She acquired a life-threatening urinary tract infection along with the multi-drug resistant Enterococcus faecium. The patient lost her life even though she was treated with antimicrobial drugs including penicillin, metronidazole, ciprofloxacin, erythromycin, and vancomycin.
(4)
To determine:
How the hospital personnel could prevent the spreading of resistant E. faecium all over the hospital.
Case summary:
In the given summary, an 85-year-old lady was hospitalized after she broke her hip by falling in the bathroom. She had a series of complications and her treatment is necessitated by a urinary catheter, a feeding tube, and an intensive antibiotic therapy. She acquired a life-threatening urinary tract infection along with the multi-drug resistant Enterococcus faecium. The patient lost her life even though she was treated with antimicrobial drugs including penicillin, metronidazole, ciprofloxacin, erythromycin, and vancomycin.
Want to see the full answer?
Check out a sample textbook solutionChapter 7 Solutions
Pearson eText Bauman Microbiology with Diseases by Body Systems -- Instant Access (Pearson+)
- Match the statement with the correct term Statement- -A group of HFr bacteria is mixed with a group of F– bacteria. After several days, the F- bacteria contain part of the Hfr chromosome -The uptake of DNA into a bacterium from its environment -Requires the presence of a plasmid -uses bacteriophage to provide new genetic information Terms- -transduction -conjugation -translation -transformation -transpositionarrow_forwardPlease make this as SIMPLE as possible Question: regarding to horizontal gene transfer please only discuss what cells are still alive or dead between transformation, trasnduction, and conjugation Be specific when discussing the donor versus recipient cell, and if the donor and recipient cells are still alive after each horizontal gene transfer event is completearrow_forwardThis is a multiple answers question. Which statement is true about CRISPR-Cas system? CRISPRS stand for clustered regularly interspaced short palindromic repeats Both bacteria and archaea can protect themselves from viral infection by using this system. Cas protein and short RNA form a complex The CRISPR region of DNA contains DNAS from previous infection by phages. Cas protein cuts target foreign DNA in pieces. The short RNA in the Cas protein and RNA complex has no function.arrow_forward
- Question: Gene therapy: a) what disease is it used for? b) what genetic defect causes the disease? c) what and how viral vector is used AND/OR CRISPR-Cas is used? d) what is in the horizen re. development of new virus-based gene delivery vesicle?arrow_forwardYou identify a new bacterial species in the koi pond between the Curry Student Center and Robinson Hall and decide to name it NE koili. You analyze the genome sequence of NE koili and find that the NE koili genome contains cas genes and pieces of various bacteriophage genomes separated by unique repeats. You roommate is baffled by this observation. Having covered this topic in BIOL2299, explain to your roommate why there are pieces of phage DNA in a bacterial genome. In your answer, include the role of cas nuclease.arrow_forwardPlease help a bit confusedarrow_forward
- please explain ALL parts of this one question clearly and in depth!arrow_forwardThis quarter in lab, you have studied two different technologies that allow us to modify the genome of a cell: transformation and CRISPR. In your own words, briefly describe two differences between these technologies. (For example, these can be differences between their outcomes, procedures, reagents, or something else.) Please respond in 2-4 sentences.arrow_forwardCoronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…arrow_forward
- Cloning vectors are not just limited to bacterial plasmids. Bacteriophages and M13 phage vectors are also commonly utilized in the cloning process. State any five (5) key criteria to be an effective cloning vector.arrow_forwardI’m having trouble finding the answer to the problem can you please help?arrow_forwardBacteriophage lambda is as one of the routinely used molecular cloning vectors, which alsoserved as a model system for the study of bacteriophage morphogenesis, DNA replication, andgene regulation.a) With the aid of a diagram, generally narrate how a foreign gene can be inserted into alambda insertion vector and subsequently infect an Escherichia coli cell.b) You are cloning a 7.5 kb gene into a lambda gt10 vector, utilizing a restriction site whichspecifically present in the vector. State the restriction site that you can use for this purposeand suggest a screening procedure to indicate successful integration of the gene into thehost genome.arrow_forward
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax