GENETICS:FROM GENES TO GENOMES(LL)-PKG
6th Edition
ISBN: 9781260377033
Author: HARTWELL
Publisher: MCG
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 19, Problem 4P
Hypomorphic mutations in the wingless gene of Drosophila result in animals lacking wings.
a. | Starting with a set of wingless mutations, how could researchers have identified the wingless gene in the Drosophila genome sequence? |
b. | Part of the amino acid sequence encoded by the ORF of the wingless gene is: (N)…EAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRL…(C) Perform a protein blast at the following website to ask whether the human genome has a gene related to the fly wingless gene: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome Enter Homo sapiens (taxid:9606) as the organism. Leave all the other settings in their default state, and hit the blue BLAST button at the bottom of the page. The results of the database search will appear in a few minutes. What do the results of the search tell you about the existence of human genes homologous to the fly wingless gene? |
Expert Solution & Answer

Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
AaBbCc X AaBbCc individuals are crossed.
What is the probability of their offspring having a genotype AABBCC?
circle a nucleotide in the image
"One of the symmetry breaking events in mouse gastrulation requires the amplification of Nodal on the side of the embryo opposite to the Anterior Visceral Endoderm (AVE). Describe one way by which Nodal gets amplified in this region."
My understanding of this is that there are a few ways nodal is amplified though I'm not sure if this is specifically occurs on the opposite side of the AVE.
1. pronodal cleaved by protease -> active nodal
2. Nodal -> BMP4 -> Wnt-> nodal
3. Nodal-> Nodal, Fox1 binding site
4. BMP4 on outside-> nodal
Are all of these occuring opposite to AVE?
Chapter 19 Solutions
GENETICS:FROM GENES TO GENOMES(LL)-PKG
Ch. 19 - Match each of the terms in the left column to the...Ch. 19 - a. If you were interested in the role of a...Ch. 19 - Early C. elegans embryos display mosaic...Ch. 19 - Hypomorphic mutations in the wingless gene of...Ch. 19 - Prob. 5PCh. 19 - In 1932, H. J. Muller suggested a genetic test to...Ch. 19 - a. Explain how you could use worms transformed...Ch. 19 - Suppose you want to determine whether a particular...Ch. 19 - Sevenless is an unusual receptor protein in that...Ch. 19 - Suppose that you generated flies containing a...
Ch. 19 - Drosophila researchers have collected many strains...Ch. 19 - As an alternative to random mutagenesis,...Ch. 19 - A C. elegans nematode gene called par-1 helps to...Ch. 19 - The molecular identity of the fruit fly rugose...Ch. 19 - To determine the focus of action of boss,...Ch. 19 - Suppose a particular gene is required for early...Ch. 19 - Researchers have exploited Minute mutations in...Ch. 19 - Some ts alleles are temperature sensitive during...Ch. 19 - The following figure shows the temperature-shift...Ch. 19 - A temperature-sensitive allele of the gene...Ch. 19 - Hypomorphic alleles of a pleiotropic gene...Ch. 19 - In addition to the maternal effect genes that...Ch. 19 - The yan gene encodes a transcription factor that...Ch. 19 - Recall from Chapter 17 that in Drosophila, sex...Ch. 19 - a. Explain the difference between maternal...Ch. 19 - In the 1920s, Arthur Boycott, working with the...Ch. 19 - The Drosophila mutant screen shown on the...Ch. 19 - Some genes are required both zygotically and...Ch. 19 - How would a human with a mutation in a maternal...Ch. 19 - One important demonstration that Bicoid is an...Ch. 19 - The hunchback gene contains a 5 transcriptional...Ch. 19 - In flies developing from eggs laid by a...Ch. 19 - Wild-type embryos and mutant embryos lacking the...Ch. 19 - The Drosophila even-skipped eve gene has four...Ch. 19 - In Drosophila with loss-of-function mutations...Ch. 19 - It is crucial to the development of Drosophila...Ch. 19 - In the plant Arabidopsis thaliana, every flower is...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- If four babies are born on a given day What is the chance all four will be girls? Use genetics lawsarrow_forwardExplain each punnet square results (genotypes and probabilities)arrow_forwardGive the terminal regression line equation and R or R2 value: Give the x axis (name and units, if any) of the terminal line: Give the y axis (name and units, if any) of the terminal line: Give the first residual regression line equation and R or R2 value: Give the x axis (name and units, if any) of the first residual line : Give the y axis (name and units, if any) of the first residual line: Give the second residual regression line equation and R or R2 value: Give the x axis (name and units, if any) of the second residual line: Give the y axis (name and units, if any) of the second residual line: a) B1 Solution b) B2 c)hybrid rate constant (λ1) d)hybrid rate constant (λ2) e) ka f) t1/2,absorb g) t1/2, dist h) t1/2, elim i)apparent central compartment volume (V1,app) j) total AUC (short cut method) k) apparent volume of distribution based on AUC (VAUC,app) l)apparent clearance (CLapp) m) absolute bioavailability of oral route (need AUCiv…arrow_forward
- You inject morpholino oligonucleotides that inhibit the translation of follistatin, chordin, and noggin (FCN) at the 1 cell stage of a frog embryo. What is the effect on neurulation in the resulting embryo? Propose an experiment that would rescue an embryo injected with FCN morpholinos.arrow_forwardParticipants will be asked to create a meme regarding a topic relevant to the department of Geography, Geomatics, and Environmental Studies. Prompt: Using an online art style of your choice, please make a meme related to the study of Geography, Environment, or Geomatics.arrow_forwardPlekhg5 functions in bottle cell formation, and Shroom3 functions in neural plate closure, yet the phenotype of injecting mRNA of each into the animal pole of a fertilized egg is very similar. What is the phenotype, and why is the phenotype so similar? Is the phenotype going to be that there is a disruption of the formation of the neural tube for both of these because bottle cell formation is necessary for the neural plate to fold in forming the neural tube and Shroom3 is further needed to close the neural plate? So since both Plekhg5 and Shroom3 are used in forming the neural tube, injecting the mRNA will just lead to neural tube deformity?arrow_forward
- Can I get this answered with the colors and what type of connection was formed? Hydrophobic, ionic, or hydrogen.arrow_forwardCan I please get this answered with the colors and how the R group is suppose to be set up. Thanksarrow_forwardfa How many different gametes, f₂ phenotypes and f₂ genotypes can potentially be produced from individuals of the following genotypes? 1) AaBb i) AaBB 11) AABSC- AA Bb Cc Dd EE Cal bsm nortubaarrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningBiology: The Dynamic Science (MindTap Course List)BiologyISBN:9781305389892Author:Peter J. Russell, Paul E. Hertz, Beverly McMillanPublisher:Cengage LearningBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
- Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage LearningBiology: The Unity and Diversity of Life (MindTap...BiologyISBN:9781305073951Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa StarrPublisher:Cengage LearningBiochemistryBiochemistryISBN:9781305577206Author:Reginald H. Garrett, Charles M. GrishamPublisher:Cengage Learning

Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning

Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning

Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax

Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning

Biology: The Unity and Diversity of Life (MindTap...
Biology
ISBN:9781305073951
Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr
Publisher:Cengage Learning

Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Genome Annotation, Sequence Conventions and Reading Frames; Author: Loren Launen;https://www.youtube.com/watch?v=MWvYgGyqVys;License: Standard Youtube License