
EBK GENETICS: FROM GENES TO GENOMES
6th Edition
ISBN: 9781260041255
Author: HARTWELL
Publisher: MCGRAW HILL BOOK COMPANY
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 19, Problem 4P
Hypomorphic mutations in the wingless gene of Drosophila result in animals lacking wings.
a. | Starting with a set of wingless mutations, how could researchers have identified the wingless gene in the Drosophila genome sequence? |
b. | Part of the amino acid sequence encoded by the ORF of the wingless gene is: (N)…EAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRL…(C) Perform a protein blast at the following website to ask whether the human genome has a gene related to the fly wingless gene: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome Enter Homo sapiens (taxid:9606) as the organism. Leave all the other settings in their default state, and hit the blue BLAST button at the bottom of the page. The results of the database search will appear in a few minutes. What do the results of the search tell you about the existence of human genes homologous to the fly wingless gene? |
Expert Solution & Answer

Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
The following figure is from Caterina et al. The capsaicin receptor: a heat activated ion channel in the
pain pathway. Nature, 1997. Black boxes indicate capsaicin, white circles indicate resinferatoxin.
a) Which has a higher potency?
b) Which is has a higher efficacy?
c) What is the approximate Kd of capsaicin in uM? (you can round to the nearest power of 10)
What is the rate-limiting-step for serotonin synthesis?
What enzyme is necessary for synthesis of all of the monoamines?
Chapter 19 Solutions
EBK GENETICS: FROM GENES TO GENOMES
Ch. 19 - Match each of the terms in the left column to the...Ch. 19 - a. If you were interested in the role of a...Ch. 19 - Early C. elegans embryos display mosaic...Ch. 19 - Hypomorphic mutations in the wingless gene of...Ch. 19 - Prob. 5PCh. 19 - In 1932, H. J. Muller suggested a genetic test to...Ch. 19 - a. Explain how you could use worms transformed...Ch. 19 - Suppose you want to determine whether a particular...Ch. 19 - Sevenless is an unusual receptor protein in that...Ch. 19 - Suppose that you generated flies containing a...
Ch. 19 - Drosophila researchers have collected many strains...Ch. 19 - As an alternative to random mutagenesis,...Ch. 19 - A C. elegans nematode gene called par-1 helps to...Ch. 19 - The molecular identity of the fruit fly rugose...Ch. 19 - To determine the focus of action of boss,...Ch. 19 - Suppose a particular gene is required for early...Ch. 19 - Researchers have exploited Minute mutations in...Ch. 19 - Some ts alleles are temperature sensitive during...Ch. 19 - The following figure shows the temperature-shift...Ch. 19 - A temperature-sensitive allele of the gene...Ch. 19 - Hypomorphic alleles of a pleiotropic gene...Ch. 19 - In addition to the maternal effect genes that...Ch. 19 - The yan gene encodes a transcription factor that...Ch. 19 - Recall from Chapter 17 that in Drosophila, sex...Ch. 19 - a. Explain the difference between maternal...Ch. 19 - In the 1920s, Arthur Boycott, working with the...Ch. 19 - The Drosophila mutant screen shown on the...Ch. 19 - Some genes are required both zygotically and...Ch. 19 - How would a human with a mutation in a maternal...Ch. 19 - One important demonstration that Bicoid is an...Ch. 19 - The hunchback gene contains a 5 transcriptional...Ch. 19 - In flies developing from eggs laid by a...Ch. 19 - Wild-type embryos and mutant embryos lacking the...Ch. 19 - The Drosophila even-skipped eve gene has four...Ch. 19 - In Drosophila with loss-of-function mutations...Ch. 19 - It is crucial to the development of Drosophila...Ch. 19 - In the plant Arabidopsis thaliana, every flower is...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- 6. The mammalian phylogenies (labeled a and b) were produced by two different research groups. a. In which tree do phylogenetic relationships most closely align with biogeography and why? (consult the Teeling and Hedges paper) b. What are the most closely related species to Chiroptera in each tree? Might the use of convergent traits for building phylogenies explain this difference? If so, which tree is most likely to have relied on convergent traits and why? c. What are some possible reasons that the two research groups came up with different phylogenies (in general terms)? describe at least three possible reasons.arrow_forwardBuild a model of a prokaryotic cell using any material of your choice. In your model be sure to include all the structures appropriate to your cell. You may model a bacterial cell or an archaea. You will model at least 4 structures in any model. Next, build a model of a virus using the same type of materials. You may choose any type of virus but be sure you can illustrate the key features of a virus (head shape for example). Once complete, take multiple photographs of your models from all angles. Include these images in a document that also contains the following completed table format. You may need to add rows to your table depending on the type of prokaryote you model. Structure Model Key Found in Different in Function Virus Virus Once your model is complete, write a brief description of your cell and your virus. Emphasize features that are absent in viruses that classify them as non-living. You can refer to specific structures in your table in this explanation. Some suggestions for…arrow_forward(This is a 2-part work, Part 1 is done, only Part 2 is to be worked on at the bottom)Part 1 (Done): Describe the levels of structural hierarchy for the human body, starting with the organismal level and ending with the chemical level. In addition, you should make sure you link each level to the previous level, emphasizing the structural relationships. The human body is organized into a structural hierarchy that progresses from the macroscopic organismal level down to the microscopic chemical level. Each level builds upon the previous one, creating increasingly complex structures. Below is the hierarchy, from largest to smallest, with explanations linking each level to its predecessor: 1. Organismal Level The entire living human body.Relationship: All lower levels work together to sustain life at this highest level. 2. Organ System Level Groups of organs working together to perform major functions.Examples: circulatory, nervous, digestive systems.Relationship: The organismal…arrow_forward
- Describe the levels of structural hierarchy for the human body, starting with the organismal level and ending with the chemical level. In addition, you should make sure you link each level to the previous level, emphasizing the structural relationships.arrow_forward9 S es Read the section "Investigating Life: In (Extremely) Cold Blood." Then, drag and drop the terms on the left to complete the concept map. Red blood cells Genes Icefishes -have mutated have colorless Oxygen have few lack encode Blood Cellular respiration consists of- contain carries is a Platelets White blood cells carries low amounts of Hemoglobin is necessary for Plasma Protein Reset.arrow_forwardPlating 50 microliters of a sample diluted by a factor of 10-6 produced 91 colonies. What was the originalcell density (CFU/ml) in the sample?arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningBiology: The Dynamic Science (MindTap Course List)BiologyISBN:9781305389892Author:Peter J. Russell, Paul E. Hertz, Beverly McMillanPublisher:Cengage LearningBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
- Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage LearningBiology: The Unity and Diversity of Life (MindTap...BiologyISBN:9781305073951Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa StarrPublisher:Cengage LearningBiochemistryBiochemistryISBN:9781305577206Author:Reginald H. Garrett, Charles M. GrishamPublisher:Cengage Learning

Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning

Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning

Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax

Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning

Biology: The Unity and Diversity of Life (MindTap...
Biology
ISBN:9781305073951
Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr
Publisher:Cengage Learning

Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Genome Annotation, Sequence Conventions and Reading Frames; Author: Loren Launen;https://www.youtube.com/watch?v=MWvYgGyqVys;License: Standard Youtube License