![Genetics: From Genes to Genomes](https://www.bartleby.com/isbn_cover_images/9781259700903/9781259700903_largeCoverImage.gif)
Genetics: From Genes to Genomes
6th Edition
ISBN: 9781259700903
Author: Leland Hartwell Dr., Michael L. Goldberg Professor Dr., Janice Fischer, Leroy Hood Dr.
Publisher: McGraw-Hill Education
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 19, Problem 4P
Hypomorphic mutations in the wingless gene of Drosophila result in animals lacking wings.
a. | Starting with a set of wingless mutations, how could researchers have identified the wingless gene in the Drosophila genome sequence? |
b. | Part of the amino acid sequence encoded by the ORF of the wingless gene is: (N)…EAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRL…(C) Perform a protein blast at the following website to ask whether the human genome has a gene related to the fly wingless gene: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome Enter Homo sapiens (taxid:9606) as the organism. Leave all the other settings in their default state, and hit the blue BLAST button at the bottom of the page. The results of the database search will appear in a few minutes. What do the results of the search tell you about the existence of human genes homologous to the fly wingless gene? |
Expert Solution & Answer
![Check Mark](/static/check-mark.png)
Want to see the full answer?
Check out a sample textbook solution![Blurred answer](/static/blurred-answer.jpg)
Students have asked these similar questions
Biopharmaceutics and Pharmacokinetics:Two-Compartment Model Zero-Order Absorption Questions
SHOW ALL WORK, including equation used, variables used and each step to your solution, report your regression lines and axes names (with units if appropriate) :Calculate a-q
a) B1,
b) B2,
c) hybrid rate constant (1)
d) hybrid rate constant (2)
e) t1/2,dist
f) t1/2,elim
g) k10
h) k12
i) k21
j) initial concentration (C0)
k) central compartment volume (V1)
l) steady-state volume (Vss)
m) clearance (CL) AUC (0→10 min) using trapezoidal rule
n) AUC (20→30 min) using trapezoidal rule
o) AUCtail (AUC360→∞)
p) total AUC (using short cut method)
q) volume from AUC (VAUC)
What are some external influences that keep people from making healthy eating decisions?
What type of structure(s) would you expect to see in peripheral membrane proteins? (mark all that apply)
A. Amphipathic alpha helix (one side is hydrophilic and one side is hydrophobic)
B. A hydrophobic beta barrel
C. A hydrophobic alpha helix
D. A chemical group attached to the protein that can anchor it to the membrane
Chapter 19 Solutions
Genetics: From Genes to Genomes
Ch. 19 - Match each of the terms in the left column to the...Ch. 19 - a. If you were interested in the role of a...Ch. 19 - Early C. elegans embryos display mosaic...Ch. 19 - Hypomorphic mutations in the wingless gene of...Ch. 19 - Prob. 5PCh. 19 - In 1932, H. J. Muller suggested a genetic test to...Ch. 19 - a. Explain how you could use worms transformed...Ch. 19 - Suppose you want to determine whether a particular...Ch. 19 - Sevenless is an unusual receptor protein in that...Ch. 19 - Suppose that you generated flies containing a...
Ch. 19 - Drosophila researchers have collected many strains...Ch. 19 - As an alternative to random mutagenesis,...Ch. 19 - A C. elegans nematode gene called par-1 helps to...Ch. 19 - The molecular identity of the fruit fly rugose...Ch. 19 - To determine the focus of action of boss,...Ch. 19 - Suppose a particular gene is required for early...Ch. 19 - Researchers have exploited Minute mutations in...Ch. 19 - Some ts alleles are temperature sensitive during...Ch. 19 - The following figure shows the temperature-shift...Ch. 19 - A temperature-sensitive allele of the gene...Ch. 19 - Hypomorphic alleles of a pleiotropic gene...Ch. 19 - In addition to the maternal effect genes that...Ch. 19 - The yan gene encodes a transcription factor that...Ch. 19 - Recall from Chapter 17 that in Drosophila, sex...Ch. 19 - a. Explain the difference between maternal...Ch. 19 - In the 1920s, Arthur Boycott, working with the...Ch. 19 - The Drosophila mutant screen shown on the...Ch. 19 - Some genes are required both zygotically and...Ch. 19 - How would a human with a mutation in a maternal...Ch. 19 - One important demonstration that Bicoid is an...Ch. 19 - The hunchback gene contains a 5 transcriptional...Ch. 19 - In flies developing from eggs laid by a...Ch. 19 - Wild-type embryos and mutant embryos lacking the...Ch. 19 - The Drosophila even-skipped eve gene has four...Ch. 19 - In Drosophila with loss-of-function mutations...Ch. 19 - It is crucial to the development of Drosophila...Ch. 19 - In the plant Arabidopsis thaliana, every flower is...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Temporal flexibility (the ability to change over time) of actin structures within a cell is maintained by… A. The growth/shrinkage cycle B. Periodic catastrophe C. GTP hydrolysis D. Treadmilling E. None of the abovearrow_forwardDuring in vitro polymerization of actin and microtubule filaments from their subunits, what causes the initial delay in filament growth? A.Nucleation B.Reaching homeostasis C.Nucleotide exchange D.ATP or GTP hydrolysis E.Treadmillingarrow_forwardYou expect to find which of the following in the Microtubule Organizing Center (MTOC)...(mark all that apply) A. Gamma tubulin B. XMAP215 C. Centrioles D. Kinesin-13arrow_forward
- The actin-nucleating protein formin has flexible “arms” containing binding sites that help recruit subunits in order to enhance microfilament polymerization. What protein binds these sites? A.Thymosin B.Profilin C.Cofilin D.Actin E.Tropomodulinarrow_forwardWhile investigating an unidentified motor protein, you discover that it has two heads that bind to actin. Based on this information, you could confidently determine that it is NOT... (mark all that apply) A. A myosin I motor B. A dynein motor C. A myosin VI motor D. A kinesin motorarrow_forwardYou isolate the plasma membrane of cells and find that . . . A. it contains regions with different lipid compositions B. it has different lipid types on the outer and cytosolic leaflets of the membrane C. neither are possible D. A and B both occurarrow_forward
- You are studying the mobility of a transmembrane protein that contains extracellular domains, one transmembrane domain, and a large cytosolic domain. Under normal conditions, this protein is confined to a particular region of the membrane due to the cortical actin cytoskeletal network. Which of the following changes is most likely to increase mobility of this protein beyond the normal restricted region of the membrane? A. Increased temperature B. Protease cleavage of the extracellular domain of the protein C. Binding to a free-floating extracellular ligand, such as a hormone D. Protease cleavage of the cytosolic domain of the protein E. Aggregation of the protein with other transmembrane proteinsarrow_forwardTopic: Benthic invertebrates as an indicator species for climate change, mapping changes in ecosystems (Historical Analysis & GIS) What objects or events has the team chosen to analyze? How does your team wish to delineate the domain or scale in which these objects or events operate? How does that limited domain facilitate a more feasible research project? What is your understanding of their relationships to other objects and events? Are you excluding other things from consideration which may influence the phenomena you seek to understand? Examples of such exclusions might include certain air-born pollutants; a general class of water bodies near Ottawa, or measurements recorded at other months of the year; interview participants from other organizations that are involved in the development of your central topic or issue. In what ways do your research questions follow as the most appropriate and/or most practical questions (given the circumstances) to pursue to better understand…arrow_forwardThe Esp gene encodes a protein that alters the structure of the insulin receptor on osteoblasts and interferes with the binding of insulin to the receptor. A researcher created a group of osteoblasts with an Esp mutation that prevented the production of a functional Esp product (mutant). The researcher then exposed the mutant strain and a normal strain that expresses Esp to glucose and compared the levels of insulin in the blood near the osteoblasts (Figure 2). Which of the following claims is most consistent with the data shown in Figure 2 ? A Esp expression is necessary to prevent the overproduction of insulin. B Esp protein does not regulate blood-sarrow_forward
- Predict the per capita rate of change (r) for a population of ruil trees in the presence of the novel symbiont when the soil moisture is 29%. The formula I am given is y= -0.00012x^2 + 0.0088x -0.1372. Do I use this formula and plug in 29 for each x variable?arrow_forwardPlease answer the following chart so I can understand how to do it.arrow_forwardDigoxin: Intravenous Bolus - Two Compartment Model Drug Digoxin Route: IV Bolus Dose: 0.750 mg Plasma Concentration Time Profile Beta Alpha Time (hrs) Conc (ng/ml) LN (ng/ml) LN (ng/ml) LN 0.00 #NUM! #NUM! #NUM! 0.10 12.290 2.509 #NUM! #NUMI 0.60 6.975 1.942 #NUM! #NUMI 1.00 4.649 1.537 #NUM! #NUMI 2.00 2.201 0.789 #NUM! #NUM! 3.00 1.536 0.429 #NUM! #NUM! 4.00 1.342 0.294 #NUM! #NUM! 5.00 1.273 0.241 #NUM! #NUMI 6.00 1.238 0.213 #NUM! #NUM! 7.00 1.212 0.192 #NUM! #NUM! 8.00 1.188 0.172 #NUMI #NUM! 9.00 1.165 0.153 #NUM! #NUMI 10.00 1.143 0.134 #NUMI #NUM! 11.00 1.122 0.115 #NUM! 12.00 1.101 0.096 #NUMI 13.00 1.080 0.077 #NUMI 16.00 1.020 0.020 #NUMI 24.00 0.876 -0.132 #NUMI Pharmacokinetic Parameters Parameter Value Alpha B Beta Units ng/ml hr-1 ng/ml hr-1 CO ng/ml H.C AUC ng x hr/ml Vc Vbeta Vss C L/hr TK (alpha) hr TX (beta) days 5+ F3 F4 F5 0+ F6 F7 % 6 95 14 #3 29 & t F8 F9 FW EWarrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningBiology: The Dynamic Science (MindTap Course List)BiologyISBN:9781305389892Author:Peter J. Russell, Paul E. Hertz, Beverly McMillanPublisher:Cengage LearningBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
- Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage LearningBiology: The Unity and Diversity of Life (MindTap...BiologyISBN:9781305073951Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa StarrPublisher:Cengage LearningBiochemistryBiochemistryISBN:9781305577206Author:Reginald H. Garrett, Charles M. GrishamPublisher:Cengage Learning
![Text book image](https://www.bartleby.com/isbn_cover_images/9781305251052/9781305251052_smallCoverImage.gif)
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
![Text book image](https://www.bartleby.com/isbn_cover_images/9781305389892/9781305389892_smallCoverImage.gif)
Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning
![Text book image](https://www.bartleby.com/isbn_cover_images/9781947172517/9781947172517_coverImage_Textbooks.gif)
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
![Text book image](https://www.bartleby.com/isbn_cover_images/9781337392938/9781337392938_smallCoverImage.gif)
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
![Text book image](https://www.bartleby.com/isbn_cover_images/9781305073951/9781305073951_smallCoverImage.gif)
Biology: The Unity and Diversity of Life (MindTap...
Biology
ISBN:9781305073951
Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr
Publisher:Cengage Learning
![Text book image](https://www.bartleby.com/isbn_cover_images/9781305577206/9781305577206_smallCoverImage.gif)
Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Genome Annotation, Sequence Conventions and Reading Frames; Author: Loren Launen;https://www.youtube.com/watch?v=MWvYgGyqVys;License: Standard Youtube License