Genetics: From Genes to Genomes
Genetics: From Genes to Genomes
6th Edition
ISBN: 9781259700903
Author: Leland Hartwell Dr., Michael L. Goldberg Professor Dr., Janice Fischer, Leroy Hood Dr.
Publisher: McGraw-Hill Education
bartleby

Concept explainers

bartleby

Videos

Textbook Question
Book Icon
Chapter 19, Problem 4P

Hypomorphic mutations in the wingless gene of Drosophila result in animals lacking wings.

a. Starting with a set of wingless mutations, how could researchers have identified the wingless gene in the Drosophila genome sequence?
b. Part of the amino acid sequence encoded by the ORF of the wingless gene is:
(N)…EAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRL…(C)
Perform a protein blast at the following website to ask whether the human genome has a gene related to the fly wingless gene: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome
Enter Homo sapiens (taxid:9606) as the organism. Leave all the other settings in
their default state, and hit the blue BLAST button at the bottom of the page. The results of the database search will appear in a few minutes. What do the results of the search tell you about the existence of human genes homologous to the fly wingless gene?
Blurred answer
Students have asked these similar questions
what key characteristics would you look for when identifying microbes?
If you had an unknown microbe, what steps would you take to determine what type of microbe (e.g., fungi, bacteria, virus) it is? Are there particular characteristics you would search for? Explain.
avorite Contact avorite Contact favorite Contact ୫ Recant Contacts Keypad Messages Pairing ง 107.5 NE Controls Media Apps Radio Nav Phone SCREEN OFF Safari File Edit View History Bookmarks Window Help newconnect.mheducation.com M Sign in... S The Im... QFri May 9 9:23 PM w The Im... My first.... Topic: Mi Kimberl M Yeast F Connection lost! You are not connected to internet Sigh in... Sign in... The Im... S Workin... The Im. INTRODUCTION LABORATORY SIMULATION Tube 1 Fructose) esc - X Tube 2 (Glucose) Tube 3 (Sucrose) Tube 4 (Starch) Tube 5 (Water) CO₂ Bubble Height (mm) How to Measure 92 3 5 6 METHODS RESET #3 W E 80 A S D 9 02 1 2 3 5 2 MY NOTES LAB DATA SHOW LABELS % 5 T M dtv 96 J: ப 27 כ 00 alt A DII FB G H J K PHASE 4: Measure gas bubble Complete the following steps: Select ruler and place next to tube 1. Measure starting height of gas bubble in respirometer 1. Record in Lab Data Repeat measurement for tubes 2-5 by selecting ruler and move next to each tube. Record each in Lab Data…

Chapter 19 Solutions

Genetics: From Genes to Genomes

Ch. 19 - Drosophila researchers have collected many strains...Ch. 19 - As an alternative to random mutagenesis,...Ch. 19 - A C. elegans nematode gene called par-1 helps to...Ch. 19 - The molecular identity of the fruit fly rugose...Ch. 19 - To determine the focus of action of boss,...Ch. 19 - Suppose a particular gene is required for early...Ch. 19 - Researchers have exploited Minute mutations in...Ch. 19 - Some ts alleles are temperature sensitive during...Ch. 19 - The following figure shows the temperature-shift...Ch. 19 - A temperature-sensitive allele of the gene...Ch. 19 - Hypomorphic alleles of a pleiotropic gene...Ch. 19 - In addition to the maternal effect genes that...Ch. 19 - The yan gene encodes a transcription factor that...Ch. 19 - Recall from Chapter 17 that in Drosophila, sex...Ch. 19 - a. Explain the difference between maternal...Ch. 19 - In the 1920s, Arthur Boycott, working with the...Ch. 19 - The Drosophila mutant screen shown on the...Ch. 19 - Some genes are required both zygotically and...Ch. 19 - How would a human with a mutation in a maternal...Ch. 19 - One important demonstration that Bicoid is an...Ch. 19 - The hunchback gene contains a 5 transcriptional...Ch. 19 - In flies developing from eggs laid by a...Ch. 19 - Wild-type embryos and mutant embryos lacking the...Ch. 19 - The Drosophila even-skipped eve gene has four...Ch. 19 - In Drosophila with loss-of-function mutations...Ch. 19 - It is crucial to the development of Drosophila...Ch. 19 - In the plant Arabidopsis thaliana, every flower is...
Knowledge Booster
Background pattern image
Biology
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.
Similar questions
SEE MORE QUESTIONS
Recommended textbooks for you
Text book image
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
Text book image
Biology: The Dynamic Science (MindTap Course List)
Biology
ISBN:9781305389892
Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan
Publisher:Cengage Learning
Text book image
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Text book image
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
Text book image
Biology: The Unity and Diversity of Life (MindTap...
Biology
ISBN:9781305073951
Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr
Publisher:Cengage Learning
Text book image
Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Genome Annotation, Sequence Conventions and Reading Frames; Author: Loren Launen;https://www.youtube.com/watch?v=MWvYgGyqVys;License: Standard Youtube License