Campbell Biology in Focus (2nd Edition)
2nd Edition
ISBN: 9780321962751
Author: Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Jane B. Reece
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 17.2, Problem 2CC
MAKE CONNECTIONS The RNA virus in Figure 17.7 has a viral RNA polymerase that functions in step 3 of the virus’s replicative cycle. Compare this with a cellular RNA polymerase In terms of template and overall function (see Figure 14.10).
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
You are studying a new retrovirus. The viral protein (X) appears to play a role in the export of the viral genomes to the
cytoplasm. Protein X brings viral DNA to the cytoplasm and returns back to the nucleus after genome export is complete.
Researchers have developed a new drug for the virus. Following treatment with the new drug, the viral protein stays in the
nucleus and cannot export the viral genomes. What is the most plausible and logical function of the drug? Use your
knowledge of nuclear transport to answer this question.
O A. The drug inhibits the binding of the viral protein and the viral genomes to the import receptor.
B. The drug inhibits the binding of Ran-GTP to the nuclear export receptor in nucleus.
C. The drug promotes the Ran GAP activity.
D. The drug blocks the NLS on the viral protein.
Virology
Viruses with negative sense RNA genomes typically, make proteins by: (Ignore retroviruses, and the unusual characteristics of coronaviruses)
Translation of short RNA transcripts generated by RDRP
Generating a DNA copy, which is then transcribed by host RNA polymerase.
Translation of the viral genome by host ribosomes.
Production of a polyprotein, which must be cleaved into smaller proteins.
Generating a negative sense genome copy, which is then translated by host ribosomes.
Chapter 17 Solutions
Campbell Biology in Focus (2nd Edition)
Ch. 17.1 - Compare the structures of tobacco mosaic virus and...Ch. 17.1 - Prob. 2CCCh. 17.2 - Compare the effect on the host cell of a ly1ic...Ch. 17.2 - MAKE CONNECTIONS The RNA virus in Figure 17.7 has...Ch. 17.2 - Why is HIV called a retrovirus?Ch. 17.2 - MAKE CONNECTIONS Compare the CRISPR system to the...Ch. 17.3 - Describe two ways in which a preexisting virus...Ch. 17.3 - Contrast horizontal and vertical transmission of...Ch. 17.3 - Prob. 3CCCh. 17 - which of me following characteristics. structures....
Ch. 17 - Prob. 2TYUCh. 17 - A human pandemic is A. a viral disease that...Ch. 17 - Prob. 4TYUCh. 17 - RNA viruses require their own supply of certain...Ch. 17 - Prob. 6TYUCh. 17 - Prob. 7TYUCh. 17 - Prob. 8TYUCh. 17 - FOCUS ON ORGANIZATION While viruses are considered...Ch. 17 - SYNTHESIZE YOUR KNOWLEDGE Oseltamivir (Tamiflu),...
Additional Science Textbook Solutions
Find more solutions based on key concepts
Relative thickness of the myocardium in different chambers; the functional significance of those differences; a...
Anatomy & Physiology: The Unity of Form and Function
11. In the early 1800s, French naturalist Jean Baptiste Lamarck suggested that the best explanation for the rel...
Campbell Biology: Concepts & Connections (9th Edition)
Identify each of the following reproductive barriers as prezygotic or postzygotic. a. One lilac species lives o...
Campbell Essential Biology with Physiology (6th Edition)
Single penny tossed 20 times and counting heads and tails: Probability (prediction): _______/20 heads ________/...
Laboratory Manual for Holes Human Anatomy & Physiology Fetal Pig Version
Why are mutants used as test organisms in the Ames test?
Laboratory Experiments in Microbiology (11th Edition)
Describe the evolution of mammals, tracing their synapsid lineage from early amniote ancestors to true mammals....
Loose Leaf For Integrated Principles Of Zoology
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Show your work pleasearrow_forwardAssume you isolate a single stranded (+) RNA virus. When you examine the proteins in the virus, you find that it does NOT contain replicase enzymes within its capsid. Which of the following is true? This virus must have a gene that encodes replicase. This virus will not be able to enter a host cell. Its genome cannot be translated (the process of translation) by the host cell ribosomes. A DNA copy of the viral genome has to be made before viral genes are expressed. This virus must lack surface antigens.arrow_forwardjust answer question --- dont need explanationarrow_forward
- A virus that has which type of genome must carry replicase within the viral particle? (choose all that apply) ds DNA ss (+) DNA ss (–) DNA ss (+) RNA ss (–) RNA Which viral type has a genome that can be directly translated? (choose all that apply) ds DNA ss (+) DNA ss (–) DNA ss (+) RNA ss (–) RNAarrow_forward1. Precise words:Find the nonspecific terms in the following sentences. Replace the nonspecific choices with more preciseterms or phrases (It is not necessary to change the sentence structure).(i) All OVE mutants showed enhanced iP concentrations.(ii) Plants were kept in the cold overnight.(iii) To provide proof of concept for our hypothesis, we studied a virus in its host cell.(iv) The present paper reports on continuing experiments that were performed to clarify thissurprising effect.(v) The first transition state is a little lower in energy than the second transition state. 2. Simple words:Improve the word choice in the following examples by replacing the underlined terms or phrases withsimpler word choices (do not change the sentence structure).(i) These data substantiate our hypothesis.(ii) The difference in our results compared to those of Reuter et al. (1995) can be accounted forby the fact that different conditions were used.(iii) For the purpose of discussing cell migration we…arrow_forwardThe diagrams below represent nucleic acid genomic material and a finished product after the viral polymerase acted on the genomic material. Name the virus (either family, genus, or particular virus is acceptable) that these diagrams represent. A is B is C is Dis Genomic material Product + sense RNA A 5' VPB -sense RNA 3' VPg 5' -sense RNA 5' cap Derived from infected cell B 3' 5' AAAAA(A) 3 + sense RNA C + sense RNA -sense RNA +sense RNA 5' 3'arrow_forward
- Coronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…arrow_forwardPen and Paper Exercise. A new virus was causing a localized epidemic in South Africa, affecting the population living along the Limpopo River Basin. Scientists working on the elucidation of more details about the virus have finally characterized it as a DNA virus (containing DNA as a genetic material and not RNA). Upon sequencing, a short DNA segment, speculated to be the structural gene of the viral genome responsible for viral replication, is shown with the following sequence: DNA sequence: 5'-CTACACTITATCGTTAATCTGCCAGAAGCACCCCTCCAGGTGTCTACTGTATGGTGTCGCCAT -3' A. "Transcribe" and form an RNA transcript based on the DNA sequence. B. If the RNA transcript formed is a messenger RNA, illustrate the amino acid sequence of the resulting polypeptide using the genetic code. *Please follow the proper directionality of both the RNA strand and the polypeptide. Indicate clearly and label correctly the ends of the molecules mentioned. C. What is/are the characteristic feature/s of the resulting…arrow_forwardRNA polymerase in Escherichia coli normally synthesizes all of the following molecules except: RNA primers during DNA replication messenger RNA (mRNA) transfer RNA (tRNA) ribosomal RNA (rRNA) heterogenous nuclear RNA (hnRNA)arrow_forward
- Can u help me to explain to me, please?arrow_forwardPlease help a bit confusedarrow_forwardLet's imagine you have discovered a new RNA virus and found a cell line to grow the viruses (lucky you!). Early experiments show virus' genome to be single-stranded RNA but you are unsure if it is positive or negative RNA. Explain how using anisomycin, an eukaryotic protein synthesis inhibitor, could potentially provide an answer.arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxBiology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage Learning
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
What is Genomics - Full Length; Author: Genome BC;https://www.youtube.com/watch?v=mmgIClg0Y1k;License: Standard youtube license