you have isolated a new protein called STICKY. you can predict from comparisons with other known proteins that STICKY contains bHLH domain. Predict the function of STICKY and rationale forthe importnce of these domains in sticky function.

you have isolated a new protein called STICKY. you can predict from comparisons with other known proteins that STICKY contains bHLH domain. Predict the function of STICKY and rationale forthe importnce of these domains in sticky function.

Biology Today and Tomorrow without Physiology (MindTap Course List)

5th Edition

ISBN:9781305117396

Author:Cecie Starr, Christine Evers, Lisa Starr

Publisher:Cecie Starr, Christine Evers, Lisa Starr

Chapter7: Gene Expression And Control

Section: Chapter Questions

Problem 1VQ

See similar textbooks

Related questions

Q: You have isolated a new protein called STICKY. You can predict from comparisons with other known…

A: The structural motifs are super secondary structures that are found on nucleic acids or protein…

Q: Take a look at the multiple-sequence alignment shown ofthe globin polypeptides, focusing on amino…

A: BLAST is a local alignment search tool that is used to obtain the nucleotide or protein sequences of…

Q: Rationalize the following observations.(a) Serine is the amino acid residue that can be replaced…

A: (a) Serine is the amino acid residue that can be replaced with the least effect on protein structure…

Q: You have isolated a new protein called STICKY. You can predict from comparisons with other known…

A: Proteins are essential nutrients for the human body. They are one of the building blocks of body…

Q: small protein has a sequence ACNCKAAPMLCARYCAMLH. The structure of this single peptide is stabilized…

Q: A sample of an unknown peptide was dividedinto two aliquots. One aliquot was treated with trypsin;…

A: Trypsin is an endopeptidase. It is a serine protease that cleaves after the basic residues such as…

Q: by namlng the amlno aclds from the N-terminal to the C- terminal. Use the long name, the 3-letter…

A: Bradykinin is a nonapeptide that means it contains 9 amino acid. At low pH, a peptide remain full…

Q: How many copies of a protein need to be presentin a cell in order for it to be visible as a band on…

A: 1 kD of protein is equal to 1.66053904 X10-18 milligrams in weight. Using this to find the weight of…

Q: That's okay; you're just stoked to be doing international collaborative research That's okay;…

A: Deoxy ribonucleic acid (DNA) is the genetic material of most organisms that carry coded genetic…

Q: Which of the following could be the DNA template for the following protein primary structum…

A: The DNA is transcribed to produce the mRNA which gets translated into protein. Proteins are polymers…

Q: Consider the hypothetical serine protease in the image, which shows the specificity pockets. The S,…

A: Proteases: These are enzymes that cleave peptide bonds of an amino acid chain of the protein. In…

Q: A new protein is discovered that contains a pleckstrin homology domain. Which of the following…

A: Pleckstrin homology domain is a domain in protein and is made up of nearly 120 amino acids. It is…

Q: Changing one amino acid within a protein sequence from a tryptophan to a stop codon would be best…

A: Mutation is the change in the nucleotide sequence of the DNA that causes a change in the mRNA.…

Q: Three polypeptides, the sequences of which are represented below using the one-letter code for their…

A: In peptide 1, - (ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG) Total number of negatively charged…

Q: Name the protein structural element shown in yellow in the figure:

A: Proteins can be defined as large biomolecules. They comprise of one or more chains of amino acids.…

Q: A protein, X, was Isolated from a pathogenlc mlcroorganism. The proteln Is a vlrulence factor whose…

A: Proteins are formed of peptide bonds formed between the amine group and the carboxyl group of the…

Q: Which of the following statements best describe(s) the mechanism by which correct protein folding…

A: Chaperonin GroEL/GroES is a molecular chaperone that facilitates folding of nascent or denatured…

Q: Search for the `P06858` a) Give information about the PTM and Processing of

A: triglyceride metabolism. Catalyzes the hydrolysis of triglycerides from circulating chylomicrons and…

Q: Monomeric, single-pass transmembrane proteins span a membrane with a single a helix that has…

A: Proteins are the polymers of amino acids. The amino acids have a distinct chemical structure and…

Q: A group of membrane proteins can be extracted from membranes only by using detergents. All the…

A: Proteins are polymers of amino acids, and each amino acid has a chiral alpha carbon to which four…

Q: A protein X is extensively methylated at lysine residues, converting it to protein Y. If the protein…

A: In ion-exchange chromatography technique, proteins are separated based on their net charge. To make…

Q: PLEASE MAKE THE DR BRUJIN GRAPH From these k-mers construct a de Bruijn graph and determine the…

A: In bioinformatics, merging and aligning fragments of a DNA sequence reconstruct the original space.…

Q: homodimers

A: Based on the oligomeric states of proteins, are classified as homodimers, homotrimers and…

Q: pu've isolated a novel protein, but you believe what you actually have is mixture of the unmodified…

A: All the techniques described above in the options use one or more criteria to separate the protein…

Q: Analyse and interpret the SCAM data in Fig. 1, and make a table (remember to include a legend) to…

A: SCAM (Substituted Cysteine Accessibility Method) is an analytical technique which is used to study…

Q: A researcher has synthesized two peptides and needs to confirm whether the peptides were synthesized…

A: Tandem MS(also called MS/MS) and ElectroSpray Ionization-Time Of Flight Mass Spectroscopy…

Concept explainers

Osmosis

In simple words, osmosis is the slow, gradual movement of a liquid through a membrane. But there are nuances to this process. For instance, there has to be an imbalance in the distribution of solute in the liquid on either side of the membrane, which has to be semipermeable. The liquid in the region with a lower solute concentration moves to the region with a higher concentration, thereby displacing the solution in the process. The objective is to equalize the concentration of molecules on both sides of the membrane; the displacement of liquid can be viewed as a byproduct of this equalization. Since there is no energy required to carry osmosis, it is considered a passive process.

Question

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.

Similar questions

Based on sequences A,B,C. Provide an anticodon sequence that would build this protein. Sequence ATCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGCCGCCAGGGCCCCGCCCCTCAGAAGTTGGTSequence BTCAGACGTTTTTGCCCCGTAACAACTTGTTACAACATGGTCATAAACGTCAGAGATGGTCAATCTCTTAATGACTSequence CTACAAACATGTAAACACACCCTCAGTGGACCAACTCCGCAACATAAACCAAACACCGCTCGCGCCGAAAAAGATATGG
Gene editing is also used to explore the structure and function ofproteins. For example, changes can be made to the coding sequenceof a gene to determine how alterations in the amino acid sequenceaffect the function of a protein. Let’s suppose that you areinterested in the functional importance of a particular glutamicacid (an amino acid) within a protein you are studying. By geneediting, you make mutant proteins in which the glutamic acidcodon has been changed to other codons. You then test the encodedmutant proteins for functionality. The results are as follows: FunctionalityNormal protein 100%Mutant proteins containingTyrosine 5%Phenylalanine 3%Aspartic acid 94%Glycine 4%From these results, what would you conclude about the…
Analyse and interpret the SCAM data in Fig. 1, and make a table (remember to include a legend) to indicate where each amino acid is located (cytoplasm, membrane, periplasm).
If you want to engineer a cytoplasmic protein to become a peroxisomal protein, which of the following amino acid sequences would you need to add? A signal sequence to its N-terminus and a KDEL sequence to its C-terminus An SKL sequence to its C-terminus A signal sequence to its C-terminus and a KDEL sequence to its N-terminus A signal sequence to its N-terminus and an SKL sequence to its C-terminus A KDEL sequence to its C-terminus
Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?
If you’re comparing the sequences of protein “R” from multiple vertebrates, arthropods, protists, and bacteria, which PAM or BLOSUM matrix would be the most suitable compared to others? Explain your reasoning.
Within a protein, certain amino acids are positively charged (e.g.,lysine and arginine), some are negatively charged (e.g., glutamateand aspartate), some are polar but uncharged, and some are nonpolar.If you knew that a DNA-binding protein was recognizingthe DNA backbone rather than a base sequence, which aminoacids in the protein would be good candidates for interacting withthe DNA?
A new protein is discovered that contains a pleckstrin homology domain. Which of the following molecules is likely to bind to the protein? PIP3 O IP 3 PI-3K Ca2+
Monomeric, single-pass transmembrane proteins span a membrane with a single a helix that has characteristic chemical properties in the region of the bilayer. Which of the three 20-amino-acid sequences listed below is the most likely candidate for such a transmembrane segment? O TLIYFGVMAGVIGTILLIS O ITPIYFGPMAGVIGTPLLIS ITEIYFGRMAGVIGTDLLIS
Compare the experimentally defined locations of the amino acids from the SCAM data with the positions predicted in the topological model. Comment on whether these experimental data are consistent with the topology model; do the data support this model? If not, how do they differ?
A small protein has a sequence ACNCKAAPMLCARYCAMLH. The structure of this single peptide is stabilized by the formation of two separate disulfide bonds, but the locations of those disulfide bonds are unknown. In order to determine the location, you purify this peptide and treat it with trypsin (cleaves peptide bond at long, positively-charged side chains). Tryptic digestion generated two peptides. Based on this result, determine the location of the –S-S– bonds. Show them in a diagram on the sequence by connecting the corresponding residues. Explain your reasoning.
What general structural feature is shared by proteins that specifically form homodimers (but not homotrimers, homoteramers etc)? Only one answer is correct. the surface consists of hydrophilic alpha-helix. the surface is highly modified by post-translational modification. the surface is permanently bound by chaperones. the surface is unstructured. the surface, or part of it, is self-complementary.