Below is the primary sequence of a viral protein. MSVVNTEIKFPTHLRSGDFAIIDGMVVEVTSVEYKPVEQAVYLKYRYHLHGNELSGSSLISAFKAVRTLEVP Which buffer(s) below would give this protein an overall positive charge? Select all that are correct Citric acid pH 3.25 Tris pH 8.5 Acetate pH 4.5 Phosphate pH 6.35 HEPES pH 7.5

Q: List all the amino acids you would expect to bind to a cation-exchange column at pH 2.

A: Chromatography is derived from two Greek words, chroma means colour and graphein means to write.…

Q: Which of these decapeptide is the most hydrophobic?

A: 1)Answer is option 1"3". It has total of 7 hydrophobic amino acids which are…

Q: The chain 3 subunit contains the amino acid sequence shown below. This sequence contains one alpha…

A: An alpha-helix is defined as a repetitive structure having a spiral structure. Alpha-helix is a type…

Q: Given a stock protein solution with a concentration of 3 mg/ml, determine the protein concentration…

A: Stock solutions are used in many laboratory procedures, in order to save space for keeping larger…

Q: If you crate the absorbance spectra of a solution containing dna protein and buffer using buffer as…

A: The absorbance spectrum is formed by plotting the Absorption values against the wavelength at which…

Q: Which of the following agents does NOT cause protein denaturation? Neutral pH Air Heat Alcohol None…

A: Introduction : Proteins are the nitrogenous organic compounds which are composed of one or more long…

Q: A nonapeptide was treated with dithiothreitol to reduce any disulfide bridges, then partially…

A: Amino acids are the basic unit of the peptide and proteins. They are joined via the peptide bonds to…

Q: Select the polypeptide sequence that is most likely to bind to positively charged DEAE resin at a…

A: Biomolecules are organic compounds found in living organisms. All living organisms will have these…

Q: How many amino acids are present in this peptide? فيكم A) 6 B) 7 C) 8 D) 9

A: We have to determine the number of amino acids present in the structure below:

Q: A DNA sample is found to contain 15% A residues. Use Chargaff's rules to estimate the percent G…

A: DNA is always present in double-stranded form except for some viruses.

Q: A Biochemist perform different experiments involving ELISA in order to determine the amount of…

A: Introduction Linear equation given as Y=0.9988 x -1.437 where Y=log A (Absorbance) and x=log [C]…

Q: You have a separate aqueous solution of the peptide DREAMY that is at a pH of 1.0. You then proceed…

A: pH = 1/log [H+]If [H+] concentration in a solution is high, pH will be low and the solution is…

Q: You are working in the lab with a polypeptide that is present in solution at 1 mg/mL. The…

A: Molarity (M) is the amount of a substance in a certain volume of solution. Molarity is defined as…

Q: What is the one letter code for this amino acid? What is the pH range that this amino acid will…

A: Amino acids are the smallest subunit of the protein, which is known to form a complex protein…

Q: What is the one letter code for this amino acid? What is the pH range that this amino acid will…

A: Amino acids are organic compounds that form the building blocks of proteins that are important for…

Q: Figure 3: ● • . ● KDa ● 97.4 66.2 45.0 ● 31.0 21.5 14.4 S-1 p-1 2.8 2-d S.3 p-3 This figure was…

A: The study of protein behavior under different conditions is a fascinating aspect of molecular…

Q: You have a stock solution of protein that you would like to dilute. How much stock protein do you…

A: Dilution is a process to lower the concentration the concentration of a solute by the addition of…

Q: 1) If the pH of the rain drops from 6 to 5 due to air pollution, the rain has become: a) two time…

A: Acid rain caused when the rain is mixed with the volatile toxic compounds like sulfur dioxide and…

Q: Design a cation exchange experiment to purify a protein with a pl of 4.2. Charge of the beads on the…

A: Amino acids are the constituent monomers of the polymer proteins. Amino acids have a characteristic…

Q: Given the Ramachandran Plot below, identify the protein components that could adopt the phi-psi…

A: Ramchandran plot is a two dimensional plot used to visualize energetically allowed regions for…

Q: at punctures the bacterial cell wall has just been recently isolated from the F the peptide reveals…

A: Trypsin cleave on the carboxy side of arginine and lysine residues. Chymotrypsin cleave on the…

Q: Mass spectrometry and X‑ray diffraction are common biochemical techniques for characterizing…

A: In order to determine the mass-to-charge ratio (m/z) of one or more molecules found in a sample,…

Q: Beta-tubulin has a molecular mass of 55 kDa. Approximately how many amino acids are found in…

A: Beta-tubulins approximately have 450 amino acids residues.  A small family of globular protein have…

Q: Select the AA residues that are lipid-facing, according to the figure below. a N15 L21 D S16 V25 L18…

A: Hydrophobic or Hydrophilic nature of amino acidHydrophilic or hydrophobic nature is imparted by…

Q: oligosaccharides are attached to proteins for a variety of reasons. They’re attached to the newly…

A: Macromolecules are large organic molecules composed of thousands of covalently connected atoms and…

Q: wavelength absorption for the amino acids below from shortest wavelength to longest in the UV…

A: UV 260nm to 280nm absorption is taken as direct readout for protein concentration in a sample.…

Q: You have a protein with MW 48kDa. How many grams of protein are in a 200 mL sample at 50 μM?

A: To calculate the amount of protein in grams in a 200 mL sample with a concentration of 50 μM, follow…

Q: Consider a mixture comprised of the proteins attached: Protein that will most strongly bind to an…

A: Anion exchange chromatography is a type of ion exchange chromatography, used to separate molecules…

Q: The peptide below is placed into a buffer with a pH = 9.1 H₂N-CH-C- -NH–CH—CNHCHC NH–CH CH3 HỌ-CH,…

A: Electrophoresis means the migration of a charged particle under the influence of an applied electric…