Below is the primary sequence of a viral protein. MSVVNTEIKFPTHLRSGDFAIIDGMVVEVTSVEYKPVEQAVYLKYRYHLHGNELSGSSLISAFKAVRTLEVP Which buffer(s) below would give this protein an overall positive charge? Select all that are correct Citric acid pH 3.25 Tris pH 8.5 Acetate pH 4.5 Phosphate pH 6.35 HEPES pH 7.5

Q: List all the amino acids you would expect to bind to a cation-exchange column at pH 2.

A: Chromatography is derived from two Greek words, chroma means colour and graphein means to write.…

Q: Which of these decapeptide is the most hydrophobic?

A: 1)Answer is option 1"3". It has total of 7 hydrophobic amino acids which are…

Q: The order reads Heparin 5o0o units Sc. The bottle read s Heparin Sodium 10, 000 units per ml. Howw…

A: The five major phases of a nursing process include assessment, diagnosis, planning, implementation,…

Q: Draw a structure for a peptide that gives Ala, Leu, & Val on hydrolysis and fails to react with…

A: Amino acids are units that build protein molecules. They are amphoteric as they possess amino as…

Q: If you crate the absorbance spectra of a solution containing dna protein and buffer using buffer as…

A: The absorbance spectrum is formed by plotting the Absorption values against the wavelength at which…

Q: Which of the following agents does NOT cause protein denaturation? Neutral pH Air Heat Alcohol None…

A: Introduction : Proteins are the nitrogenous organic compounds which are composed of one or more long…

Q: The graph below is a standard curve generated by plotting the distance travelled by the size…

A: The standard curve generated for an analysis involving separation of proteins along the SD-PAGE gel…

Q: Proteins pl Fibrinogen 5.8 Hemoglobin 7.1 Lysozyme 11.0 Pepsin 1.0

A: Elution: - It is the process of separating one substance with the other by the process of washing…

Q: The simple form of |Hoff equation is: Il = [B]RT In this equation the [B] is the molar concentration…

A: Given Values:  The final equation of the Hoff equation is changed to this form which is as follows:…

Q: The peptide segment shown below is part of a right-handed alpha helix. Please indicate the hydrogen-…

A: Peptide bond is formed between two amino acids. Polymerisation of amino acids via peptide bond…

Q: In the amino acid sequence below, the amino acid residue in red was shown to be essential to the…

A: Peptides or proteins are composed of twenty standard amino acids. These standard amino acids differ…

Q: A protein molecule is approximately spherical and has a hydrodynamic diameter of 35μm. What is the…

A: The protein interaction is classified as one of the most important and fundamental steps in the…

Q: Select the polypeptide sequence that is most likely to bind to positively charged DEAE resin at a…

A: Biomolecules are organic compounds found in living organisms. All living organisms will have these…

Q: When combining 1ml of lysosome solution with a concentration of 5mg/ml and 1ml of water what is the…

A: Tiny, simple sack-like structures present in cytoplasm of cells are lysosomes. These are also known…

Q: A microorganism was streaked onto 4 nutrient agar plates and the plates were incubated at different…

A: Nutrient agar  A type of general media that supports growth of wide variety of microorganisms.

Q: Which classes of biomolecules would be best separated using normal phase chromatography? Why?

A: In normal phase chromatography, the stationary phase is polar in nature and the mobile phase is…

Q: A Biochemist perform different experiments involving ELISA in order to determine the amount of…

A: Introduction Linear equation given as Y=0.9988 x -1.437 where Y=log A (Absorbance) and x=log [C]…

Q: When using a buffer pH • the target protein's pl, it will have a net charge. When running ion…

A: Ion exchange chromatography is an analytical tool that separates the compound on the basis of…

Q: Protein Description A 35 kDa monomer Disulfide-linked homodimer comprised of 19 kDa monomers…

A: Protein is made by amino acids and in living organisms, 22 types of amino acids exist and each has a…

Q: Please draw the figure with all the figure's visas by hand Note: The drawing should look like a…

A: The plasma membrane of a cell has a phospholipid bilayer, it has protein in the form of integral…

Q: What to submit: Draw in the hydrogen bonds for parallel and antiparallel sheets and replace the…

A: The proteins are a major class of biological macromolecules that are composed of amino acids…

Q: Analysis of a protein is taking place. The enzymic acivity of this protein is stable up to…

A: Ion exchange chromatography is a type of chromatography where we separate the molecules based on…

Q: Figure 3: ● • . ● KDa ● 97.4 66.2 45.0 ● 31.0 21.5 14.4 S-1 p-1 2.8 2-d S.3 p-3 This figure was…

A: The study of protein behavior under different conditions is a fascinating aspect of molecular…

Q: Look at the amino acid composition of a protein given in the table and click on the area in the 2D…

A: the isoelectric point of an amino acid is the pH at which the net electric charge of that amino acid…

Q: A direct curren was passed through a solution containing valine, histidine, and aspartic acid a pH…

A: Amino acids are composed of carbon, nitrogen, hydrogen, and oxygen atoms. Each amino acid has a…

Q: H,N NH2 H,N NH, он H,N но OH

A: Protein is made up of different amino acids Joining. These amino acids are joined together by…

Q: Which of the following chromatographic techniques allows a faster elution of polar proteins? O…

A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…

Q: Design a cation exchange experiment to purify a protein with a pl of 4.2. Charge of the beads on the…

A: Amino acids are the constituent monomers of the polymer proteins. Amino acids have a characteristic…

Q: Two proteins bind the same ligand, and the data is shown below. What is the KD value for Protein B?…

A: The answer of the above question is: Correct answer not given. KD is the equilibrium dissociation…

Q: 1. Please come up a peptide sequence for the two proteins shown in the diagram. Multi-pass…

A: Amino acid sequencing is the process of determining the arrangement of amino acids in proteins and…

Q: The amino acid residue sequence of the hemoglobin beta subunit polypeptide would represent what type…

A: Hemoglobin, the protein present in the red blood cells is responsible for the transport of gases…

Q: Beta-tubulin has a molecular mass of 55 kDa. Approximately how many amino acids are found in…

A: Beta-tubulins approximately have 450 amino acids residues.  A small family of globular protein have…

Q: Why is denaturing the proteins necessary for SDS PAGE to work? Use YOUR OWN BERITEL

A: Introduction  Proteins are large, complex molecules that perform a wide range of essential functions…

Q: What is the correct pairing of the Ramachandran plots with the protein structures they quantify? A B…

A: The main chain N- and C-bonds are largely free to spin in polypeptides. The torsion angles phi and…

Q: oligosaccharides are attached to proteins for a variety of reasons. They’re attached to the newly…

A: Macromolecules are large organic molecules composed of thousands of covalently connected atoms and…

Q: Fill the table given the info below. Please thank you. Protein at 1 mg/mL which is also 1g/L. Use…

A: To fill out the table given the provided information and the DNA sequence, we will need to calculate…

Q: The peptide below is placed into a buffer with a pH = 9.1 H₂N-CH-C- -NH–CH—CNHCHC NH–CH CH3 HỌ-CH,…

A: Electrophoresis means the migration of a charged particle under the influence of an applied electric…

Q: I had a protein that was pH 5.6. I then used ion exchnage chromatography with the equilibration…

A: Ion exchange chromatography is used for the separation of charged molecules. In this type of…

Q: Draw a diagram of a Ramachandran plot. Indicate the location on the plot of an amino acid residue…

A: There are four types of biological macromolecules- proteins, nucleic acids, lipids and…

Q: The peptide below is placed into a buffer with a pH = 1.73 H3N-CH- CH2 NH—CH—C H3C-CH NH—CH—C NH—CH-…

A: Electrophoresis means the migration of a charged particle under the influence of an applied electric…

Q: Which of the following base change will result in the alteration of the net charge of the amino acid…

A: Proteins are composed of amino acids, which are joined together through peptide bonds. Proteins are…

Q: 3. Given the following peptide sequence, GSICDNCR, the estimated net charge at the given pH is: a)…

A: Peptides: Organic substances known as amino acids include both amino and carboxylic acid functional…