Suppose part of the amino acid sequence of a protein is N... Gly-Ala - Pro-Arg-Lys ...C. Which of the following amino acid sequences could result from a frameshift mutation (+1 or -1) in the part of the gene that encodes this sequence of amino acids? O O N... Gly- Ala-Asn - Ser - Leu ...C N...Ala-Ala-Arg-Pro - Lys...C N...Gly-Gly-Thr-Thr-Glu...C N... Gly-Ala-His-lle - Val ...C N... Gly-His-Thr - Met - Val ...C

Suppose part of the amino acid sequence of a protein is N... Gly-Ala - Pro-Arg-Lys ...C. Which of the following amino acid sequences could result from a frameshift mutation (+1 or -1) in the part of the gene that encodes this sequence of amino acids? O O N... Gly- Ala-Asn - Ser - Leu ...C N...Ala-Ala-Arg-Pro - Lys...C N...Gly-Gly-Thr-Thr-Glu...C N... Gly-Ala-His-lle - Val ...C N... Gly-His-Thr - Met - Val ...C

Human Anatomy & Physiology (11th Edition)

11th Edition

ISBN:9780134580999

Author:Elaine N. Marieb, Katja N. Hoehn

Publisher:Elaine N. Marieb, Katja N. Hoehn

Chapter1: The Human Body: An Orientation

Section: Chapter Questions

Problem 1RQ: The correct sequence of levels forming the structural hierarchy is A. (a) organ, organ system,...

See similar textbooks

Similar questions

What amino acid would a tRNA with anticodon CUA carry? Enter the 3 letter code only [A]. [e.g. Met for anticodon UAC]
a. Identify the type of mutation shown below. b. How many amino acids are affected? c. What type of impact will this mutation have on the functionality of the protein? Second Letter UUU UUC UUA JUG UCu uCC UCA UCG UAU UAC UGU UOC Phe Tyr Cys Ser UAA Stop UGA Stop UAG Stop UGG Trp Leu cu cc Pro CUU COU CAU His CAC CUC CUA Leu Arg CCA Cca CGA CUG CAA Cin CAG AGU AGC AGA Arg AAU AUU AUC le AUA AUG Met ACO ACU ACC ACA Asn Ser AAC The MA AAG Lys AGG CAL KAC GUU Aep GUC Val CUA OCC Ala OCA GA Clu GAG Oly GOA GUG GGG Original DNA strand G AC 1. G. G. Mutated DNA strand GA Third letter
AAAGAGAAAAGAAUA to AAAGAGAAAUGAAUA. Suppose the codon sequence has a single base pair mutation If the old protein sequence was Lys-Glu-Lys-Arg-Ile, what will be the new sequence encoded by the mutant gene? (Use the 3-letter amino acid abbreviations with hyphens and no spaces in between, i.e. Ser-Asn-Tyr-Leu-Pro.) Submit Answer Retry Entire Group No more group attempts remain
Bovine insulin is composed of two polypeptide chains that are linked together covalently. The two chains have the following sequences: GIVEQCCASVCSLYQLENYCN - A chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA - B chain a. Through which amino acids are these two chains linked together covalently? b. How many different ways can these two chains be linked? c. Of the different connectivities you enumerated in part b, which is the biologically active form?
Which of these mutations would you predict to be most detrimental? Explain your answer. (Refer to a chart of amino acid structures as necessary.) Asp to Glu Asn to Glu Cys to Lys Pro to Gly Val to Thr
What would be the effect of a mutation that causes a poly(A)-binding protein to be nonfunctional?
2. Of the two sequences, which is more likely to have helical structure. Explain. a) -Glu-Asp-Glu-Glu-Asp-Leu- b) -Glu-Leu-Asp-Arg-Val-Lys-