Bovine insulin is composed of two polypeptide chains that are linked together covalently. The two chains have the following sequences: GIVEQCCASVCSLYQLENYCN - A chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA - B chain a. Through which amino acids are these two chains linked together covalently? b. How many different ways can these two chains be linked? c. Of the different connectivities you enumerated in part b, which is the biologically active form?

Q: How do you identify the N vs C terminals?  For the first part of the question, do you then list the…

A: Amino acids are the monomers of a polypeptide or protein. Amino acids contain an amino (-NH2) group…

Q: A solution of peptide of unknown sequence was divided into 2 samples. One sample was tre with…

A: Site specific proteases are enzymes that cleaves polypeptide chains only at specific sites i.e. at…

Q: Two proteins have exactly the same amino acid sequence. Protein A is able to bind with high affinity…

A: Only certain substances can diffuse through the cell membrane as the cell membrane is selectively…

Q: A protein with a molecular weight of about 12,000 Da was isolated in elevated quantities from cells…

A: A peptide is chain of amino acid sequences linked together via a peptide bond. The amino acid…

Q: a. Identify the type of mutation shown below. b. How many amino acids are affected? c. What type of…

A: Mutation -  Mutation is defined as the sudden inheritable changes in the structure of the DNA or in…

Q: Name the enzyme responsible for binding of aminoacid to trna?

A: Ribonucleic acid (RNA) is a biomolecule that plays important role in coding, decoding, and…

Q: In a folded protein, Glu116 is close in three-dimensional space to Lys224. The pKa of the carboxylic…

A: pKa is the pH at which a weak acid is 50% dissociated. Alternatively, pKa = -log Ka. In acid-base…

Q: Glucagon is a peptide hormone consisting of 29 residues that are released into the blood. It works…

A: A protein is considered to be a biological macromolecule made up of one or more polypeptide…

Q: Consider the following peptide sequence: Met-Ser-Val-Thr-Ile-Lys-Ala-Cys-Leu-Ser-lle-Tyr-Phe-Ser…

A: Structure of a protein or a peptide is described in four levels: primary, secondary, tertiary and…

Q: In sickle cell anemia, an inherited form of anemia in which the hemoglobin distorts the red blood…

A: The mutation that alters the codon that codes for a specific amino acid is called missense mutation.…

Q: What is the basic recognition motif to which a N-linked glycan is added? A.S/T-X-X B.KDEL…

A: Introduction N-linked Glycosylation (NLG) Is A Complicated Biosynthetic Process That Controls…

Q: mRNA: TCCGATGCCACGGGTCATCTCGGACGTGTGAATCGA 3. Your mRNA will now be translated. Refer to the genetic…

A: Inside the nucleus of the cell , DNA act as a  template for the manufacturing of single strand of…

Q: Draw a diagram of the tetrapeptide Asn-Trp-Met-Ala (show all side chains and draw all peptide bonds…

A: Amino acids are the building blocks of proteins. A peptide bond is formed between the carboxy…

Q: How would tissue(ECM)be affected by the following mutation: Collagen(GXP50) mutation, where 50…

A: Extracellular matrix(ECM): Extracellular matrix is a complex network of collagen fibers found just…

Q: Which of the following could be the DNA template for the following protein primary structum…

A: The DNA is transcribed to produce the mRNA which gets translated into protein. Proteins are polymers…

Q: Consider the following peptide sequence: Lys-Leu-Ile-Cys-Lys What is the net charge of this…

A: Physiological pH  Physiological pH, where pH means  power  hydrogen, is the acid base balance in the…

Q: Why do children need comparatively significant quantities of amino acids like arginine and…

A: Amino acids are a monomers of the polypeptide chain, and they are known to conduct a variety of…

Q: Which letter in the diagram below is pointing to the anticodon

A: A trinucleotide sequence that is complementary to a corresponding codon in a messenger RNA sequence…

Q: A portion of an unknown enzyme has the amino acid sequence serine – phenylalanine – glutamate –…

A: In Central dogma, DNA is converted into RNA through the process of transcription and RNA is…

Q: image, to determine the codons used to code for each amino acid indicated by a number.   For each…

A: The wobble position of a codon refers to the 3rd nucleotide in a codon. At the time of protein…

Q: Tyrosine is a nonessential amino acid in humans. Under what circumstance would it become an…

A: Amino acids are biomolecules serving as the building blocks of proteins. These have a carboxylic…

Q: The phosphorylation of proteins is an important regulatory mechanism. a. Name three amino acids…

A: Phosphorylation of amino acids in protein is an important post-translational modification for…

Q: Shown below is an internal fragment of a polypeptide. If this polypeptide were growing, onto which…

A: The incorporation of an amino acid into a protein follow specific trend with respect to the ends of…

Q: Glucagon is a peptide hormone consisting of 29 residues that are released into the blood. It works…

A: A protein is considered to be a biological macromolecule made up of one or more polypeptide…

Q: Which amino acids would be expected to produce a similar sickling effect if substituted for Val at…

A: The blood disease Sickle-cell anemia occurs due to a substitution mutation. The mutated form of…

Q: Consider the image of the attached protein.  Now imagine you have a proteolytic enzyme that cleaves…

A: The mentioned proteolytic enzyme cleaves the peptide-bonds on the C-terminal sides of basic amino…

Q: Pleaseeeeeeeee explain the processs of this I’m so confuseddddddd………….

A: Refer to the solution

Q: Erk and P-Erk live in two different locations within the cell even though they are just two…

A: * Mitogen activated protein kinase also called as  MAPK and  p42MAPK, and ERK2 * It is an enzyme…