Answered: Using proper convention, provide the…

Using proper convention, provide the amino acid sequence for the following protein. O H₂N-CH- CH₂ H₂O NH -N-CH- H -N-CH- CH₂ OH CH₂ OH

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Similar questions

Which abbreviation is this following peptide? GKH QGR HK GHK GHL
Give the amino acid sequence with some little explanation please. 5′ –GUACUAAGGAGGUUGUAUGGGUUAGGGG ACAUCAUUUUGA–3′
Name all the amino acids that cannot exist as zwitterions. Please explain.
Write the structure formula, three-letter and one-letter abbreviation for each essential amino acid at pH 7. Tryptophan Valine Leucine Isoleucine
For each amino acid, show the structure, 1-letter abbreviation, 3-letter abbreviation, class (non-polar, polar, positive or negative), special props, side chain pKa)
Identify the type of mutation present in the CDS and discuss the implications on the protein.
How do you translate this into amino acid sequence UGUCAUGCUCGUCUUGAAUCUUGUGAUGCUCGUUGGAUUAAUUGU
Please don't provide handwriting solution
TAC/ACC/GAC/GAA/AAT/TGT/TAC/CGT/TCA/AAC asap please
You discovered a (tiny) novel protein and figured out that the protein sequence was: Met-Ala-Arg-Gly-Trp-Ala-Pro Work backwards (showing your work) to identify 2 possible DNA sequences that might encode your protein. Sequence 1: ______________________________________________________________________ Sequence 2: ______________________________________________________________________ Based on these sequences, is there anything you could infer about where this organism might live? Could the DNA in your possible sequences be beneficial for any particular environments?
Using the genetic code, interpret the following set of nucleotides. AUGGGUCCAUGGCGUAGGCCAAAUGAUGAGGAAUGA
1) You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide |protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280nm? Select the best answer. a) Measuring absorbance at higher wavelengths, like 595nm or 562nm, is more accurate than measuring absorbance at 280nm. b) The Bradford…