The manganese ion in the center is attached to 1aspartate ligand, 1 cysteine ligand, and 2histidine ligands. The glutamate residue on thebottom is hydrogen bonded to the histidine sidechain. The pKa of the water that is attached ontop is 7.Part a) If the cysteine ligand was changed to ahistidine ligand, how would the pka of the waterchange? Explain.Part b) If the glutamate residue was changed toleucine, how would the pka of the water change?Explain.OHzHis

Answered: Image /qna-images/answer/07c7a763-5228-49b4-bdf0-941d0398a1e4.jpg

The manganese ion in the center is attached to aspartate ligand, 1 cysteine ligand, and 2 istidine ligands. The glutamate residue on the pottom is hydrogen bonded to the histidine side chain. The pKa of the water that is attached on on is 7

The manganese ion in the center is attached to aspartate ligand, 1 cysteine ligand, and 2 istidine ligands. The glutamate residue on the pottom is hydrogen bonded to the histidine side chain. The pKa of the water that is attached on on is 7

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Related questions

Q: The distance between the porphyrin plane and proximal histidine is longer in T-state than that in…

A: Answer- In Tensed state iron exist as +2 oxidation state i.e iron have larger size due to which…

Q: The cleavage pattern for o-lodosobenzoate is C-terminal to tryptophan; the cleavage pattern for…

Q: PyMol commands needed to make the following image of a helix (residues 84-104) found in the Ras…

A: The objective of the question is to generate a specific image of a helix (residues 84-104) found in…

Q: 19. Where do the following enzymes cleave peptides at? (i.e. what residue) carboxypeptidase trypsin…

A: In this question, we will see that where do the following enzyme clevage peptide bond in peptide…

Q: Drew the structure of the first non-peptide product released upon trifuoroscetic acid treatment in…

Q: † 14.) A reversible inhibitor that is unable to bind to the ES complex A) always binds in the active…

A: que . 1 A reversible inhibitor that is unable to bind to the ES complex --B) may be an…

Q: Draw the ionisation states of Proline, Tyrosine and Cysteine and their pka's.

Q: How many potential binding sites do you see in chymotrypsin? What is the chemical nature of each…

A: Chymotrypsin is an enzyme that acts in the digestive system of the organisms. It acts as a catalyst…

Q: Match the following: Active site adapts to shape of substrate Prevents substrate from entering…

A: This question is related to enzyme inhibition

Q: Provide a simple sketch of the covalent intermediate likely to form between active site serine…

A: Diphenylcarbamyl chloride aka diphenylcarbamoyl chlroide is a very toxic chemical, It is a very…

Q: For the hydrophobic aggregation of two Concanavalin A subunits (below), ∆S = +0.151 kcal mol-1 K-1.…

A: A multiple choice question based on thermodynamics, which is to be accomplished.

Q: Below is a figure of the chymotrypsin active site. Trypsin is a serine protease with an identical…

A: The objective of this question is to analyze the statements to identify the one that is likely to be…

Q: #14

A: kcat is the turnover number in an enzyme catalysis, i.e., the number of times, an enzyme site…

Q: The pKa values for the two ionizable functional groups (3.39 and 8.03)differ considerably from the…

A: The Ka is defined as the dissociation constant for acids that is those species which on dissociation…

Q: Chymotrypsin belowl is a globular protein and is a precursor of the digestive enzyme trypsin in the…

A: Chymotrypsin is a globular protein. Chymotrypsin is a proteolytic enzyme. It is synthesised in the…

Q: Where would you expect to find a cysteine unit in the tertiary structure of a water-soluble globular…

A: The objective of the question is to understand the positioning of cysteine in the tertiary structure…

Q: Phosphorylation of a serine residue in a 50 kDa protein will have a w effect on protein isolectric…

Q: What coenzymes or cofactors, amino acids, and structural features are present at the ligand or…

A: Myoglobin is a monomeric protein having molecular weight 17000 Dalton. It has a single polypeptide…

Q: 10. Will the peptide coupling proceed to afford a single dipeptide as intended? Explain. OH HN. DCC…

A: amino acid have reactive amine and reactive carboxylic group

Q: What does Y409 act as? A. a general acid/base catalyst B. an electrostatic catalyst C. a covalent…

A: The substances which enhance the rate of the reaction without undergoing any permanent chemical…

Q: Which of the following amino acid side chains can form an imine with a substrate?

A: Imines are formed always when primary amines reacts with aldehyde or ketone.

Q: None

A: let's analyze each statement carefully. If K is mutated to E (in this peptide), the mutant peptide…

Q: 409). (D149) OH H. OH coo -N R374 но. OR 1st Step (E117) ROH (Y409). (D149) OH OH R' -N R374 но-…

A: Acids: The organic compounds which have the tendency to donate H+ ions(protons) For example HCI…

Q: Consider the partial sequence of a peptide. I L W A N R M S H V L F A V E A Select all amino acid…

Q: Tetrapeptide A is completely hydrolysed under acidic conditions to yield alanine, aspartic acid,…

A: Given that:Tetrapeptide A is completely hydrolyzed under acidic conditions to yield alanine,…

Q: Given the following peptide SEPIMAPVEYPK(a)…

Q: Show by a series of equations (with structures) the first stage of the Edman method applied to a…

A: Edman degradation given by Pehr Edman, it is a process of purifying protein by sequentially removing…

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this region.…

A: There are two secondary structures: 1. Alpha Helix 2. Beta sheets RRPVVLMAACLRPVVFITYGDGGTYYHWYH…

Q: 8. Identify the inhibitor from the following list for the selective target of the enzyme having C in…

A: o Acrylamide groups act as Michael acceptors and thus react with nucleophiles like thiol (SH) groups…

Q: The E1 component contains active sites/s at the interface of the subunits. 1: alpha and beta O2;…

A: E1 catalyzes pyruvate decarboxylase. It contains 1 alpha active sides at the interface of beta…

Q: Calculate the index of hydrogen deficiency of this compound Q.) Urea, CH4N2O

A: The rings and multiple bonds reduces the hydrogen count by two and it is known as index of hydrogen…

Q: A researcher found that a single point mutation in the genome of the SARS-CoV-2 virus resulted in…

A: Answer:The most plausible explanation for the improved capacity of the SARS-CoV-2 virus to elude the…

Q: None

A: Acarbose is a drug that slows down the body's breakdown of carbs in order to treat type 2 diabetes.…

Q: Given the following peptideSEPIMAPVEYPK(a) Estimate the net charge at pH 7 and at pH 12. Assume the…

Q: How do we ban this compound with its reaction mechanism

A: The above given compound is Aspartame. It is used as artificial sweetners.

Q: Determine the pl for this synthesized pentapeptide: A-B-C-D-E Given that the pK values for the amino…

Q: Part B Rank the following peptides from most to least hydrophobic. Rank the peptides from most to…

A: Hydrophobic amino acids are those with side-chains that do not like to reside in an aqueous (i.e.…

Q: We talked in class about how the active site (specifically the "deep, hydrophobic pocket") accounts…

A: IntroductionThe active site of chymotrypsin contains a "deep, hydrophobic pocket" that accommodates…

Concept explainers

Spectroanalytical Methods

Spectroanalytical methods measure the wavelength and intensity of radiations that are either emitted or absorbed by a molecular or atomic species. These methods are useful for evaluating the electronic or atomic arrangement of the molecules of a given analyte.

Question

The manganese ion in the center is attached to 1
aspartate ligand, 1 cysteine ligand, and 2
histidine ligands. The glutamate residue on the
bottom is hydrogen bonded to the histidine side
chain. The pKa of the water that is attached on
top is 7.
Part a) If the cysteine ligand was changed to a
histidine ligand, how would the pka of the water
change? Explain.
Part b) If the glutamate residue was changed to
leucine, how would the pka of the water change?
Explain.
OHz
His

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps with 2 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

state at low partial pressure of oxygen to release more oxyge 2. Hemoglobin is able to reversibly bind oxygen (O₂) due to (a) cooperativity (b) proximal histidine (c) distal histidine (d) ferrous ion
Serine esterase contains a catalytic triad at its active site. Which amino acid in serine esterase is responsible for mediating general acid catalysis for the breakdown of tetrahedral intermediate to the carboxyl product? Explain.
FAST
Draw the relevant chemical structures for each protonation state of Glutamate (Glu) and calculate the Isoelectric Point (pI) . Must show each chemical structure drawing and work for the calculation.
In the case of serine, threonine and tyrosine they have the -OH group in their residue. I'm wondering even though all of them has the -OH groups in their residue. but only the tyrosine has the pKa value with the -OH grouup.
Please Indicate the coordination number for the iron surfur protein in the picture. A) 5 B) 6 C) 3 D) 4 E) 2
Give detailed Solution with explanation needed (don't copy the answer)
Ranitidine sulfur-containing side chain has substituted guanidine with pka of 2.7 for the secondary amine. Thus, this side chain is thus at physiological pH? N-CH₂ Rantine CH₂ NO₂ Currently Selected: B A lonized; protonated B Unionized, Deprotonated Clonized, deprotonated D Unionized, profonated and
Ni(II)-aminopyridine complex was synthesized using a metal-template condensation reaction presented below. Compound C is the target compound, but other Ni complexes can be produced as well as the intermediates of the reaction. H Н он H H2N H2N Ni(CIO,2 'N + HN N Ni2* HN 2 CIO, N N* HN 2 CIO, N N2* HN 2 CIO, H2O-ELOH reflux H2N. A B What spectral features would you expect to see in MS and IR to determine whether the synthesis was fully successful/complete?
3. The Michaelis Constant for an enzyme is A) the rate of product formation B) 12 Vmax C) the initial turnover rate D) a substrate concentration
Give detailed Solution with explanation needed
1.Serine protease is one of the most studied mechanisms in biochemistry. A. Using the diagram provided, discuss the key feature of the mechanism. B. Not shown in this diagram, there is a hydrophobic pocket on the enzyme. Why does it have a hydrophobic pocket? C. What effect would there be if in the active site histidine were replaced with lysine? Explain. Please refer to photo for the diagram