Answered: Dutline the steps used to find values…

Science

Chemistry

Dutline the steps used to find values for a BLOSUM amino acid similarity matrix.

Principles of Instrumental Analysis

7th Edition

ISBN:9781305577213

Author:Douglas A. Skoog, F. James Holler, Stanley R. Crouch

Publisher:Douglas A. Skoog, F. James Holler, Stanley R. Crouch

Chapter30: Capillary Electrophoresis, Electrochromatography, And Field-flow Fractionation

Section: Chapter Questions

Problem 30.3QAP

See similar textbooks

Related questions

Q: 22. On lieating, 131g of calcium carbonate gave 069g of caleium oxide, Cao (Ca-40, C-12.O=16) CaCOs…

A: Hey, since there are multiple questions posted, we will answer first question. If you want any…

Q: Each ionizable group of an amino acid can exist in one of two states, charged or neutral. The…

A: Histidine has the three ionizable functional groups and we have to assign proper pKa and net charge…

Q: One of the most advanced methods for determining a protein sequence is tandem mass spectrometry…

A: Tandem mass spectroscopy includes the coupling of two or more mass analyzers to significantly…

Q: Given an amino acid sequence, you perform a FASTA search and find one match with an E value of le-³.…

A: The objective of the question is to identify the correct option.

Q: do so, they need to first prepare 500.0 mL of 1.000 M of the Tris buffer solution of pH 7.5000. The…

Q: Consider an amino acid with the following pKa values: pKa1 = 2.71 and pK, = 9.31 At what pH value in…

A: Amino acids are amphoteric in nature due to the presence their ionizable α-amino and α-carboxylic…

Q: 1-proteins-lab-manual?module_item_id=44333 A= abc Where "A" is absorbance, "a" is molar…

A: First question had been answered. Absorbance of a solution can be calculated using Beer Lambert law.

Q: The pH at which the concentration of the zwitterionic form (dipolar form) of an amino acid is at its…

A: As we know amino acid structure allows them to behave both as acid or base and because of this they…

Q: The image below is a positive ionization mode Electrospray ionization-mass spectrum (ESI-MS)…

A: A multiple choice problem based on mass spectrum, which is to be accomplished.

Q: Classify the following characteristics as a type of 3D protein structure. Primary, Secondary…

A: From given structures It is matched with each of the specific component and function accordingly as…

Q: The denaturing of proteins occurs when the stabilizing forces are altered. Below is the set of…

A: Denaturation is a process in which the peptide bonds are break down between the protein chain. It…

Q: The amino acid histidine has ionizable groups with pKa values of 1.8, 6.0, and 9.2, as shown. H₂N-CH…

Q: riefly explain how you will separate amino acids mixture using the charge difference between the…

Q: If the pl for asparagine is 5.43, draw the structure at a pH of 9.5?

A: The pl for asparagine = 5.43 pH = 9.5

Q: Produce a reading outline for the chapter on amino acids and the section that introduces the peptide…

A: Since you have asked multiple questions, we will solve the first question for you. For any…

Q: The amino acid histidine has ionizable groups with pKą values of 1.8, 6.0, and 9.2, as shown. COO…

A: Molarity of Histidine solution = 0.11 MThe volume of Histidine solution taken = 80 mLpH of Histidine…

Q: Which protein folding interaction(s) is/are most likely to occur on the outside of a protein pocket…

A: Hydrophobic effects describe the energetic preference of non polar molecular surfaces interacting…

Q: Describe the pH range of acceptable buffering behavior for the amino acids alanine, histidine,…

A: The pH range of amino acids alanine, histidine, aspartic acid, and lysine is to be described. Amino…

Q: Are there methods other than spectrophotometry to determine protein concentration? If there is,…

A: Protein Concentration: Protein concentration is referred to as the overall amount and content of a…

Q: Determine the buffer capacity of Alanine and Histidine at pH 2.0 and 6.0 respectively and discuss…

A: For the alanine, the value for pKa is 2.34. Now the salt to amino acid ratio to achieve the pH of…

Q: Most of the ultraviolet absorption of proteins at 280 nm is due to their content of a. Glutamate b.…

Q: The amino acid histidine has ionizable groups with pKa values of 1.8, 6.0, and 9.2, as shown. COOH…

A: Molarity of Histidine solution = 0.11 MThe volume of Histidine solution taken = 80 mLpH of Histidine…

Q: A mixture of three proteins with pl = 7.5, 6.5, and 5.5 is separated using a DEAE-Sepharose column…

A: A pH value at which any molecule has no net electrical charge is known as its isoelectric point…

Q: Protein sequence is always read (blank) terminal to (blank) terminal. And DNA sequence is always…

A: Protein sequence is always read N terminal to C terminal. Polypeptide:

Q: Name two more methods, besides the Bradford Assay, for determining protein concentration.

A: The concentration of a protein is defined as the total amount or content of a specific protein or an…

Q: Identify the features of the two bonded amino acids depicted in the image. HOH H | || N-C-C-N-C-C CH…

A: Amino acids are basically the building blocks of proteins. They consist of an amino group (-NH2) and…

Q: Why are weak interactions important for maintain protein structure?

Q: Complete the Ksp expression for Ag₂CO3. Ksp = 8.46 × 10-12 =

Q: Dr. Alghe has just performed a restriction digest on DNA she extracted from her samples. She must…

A: The mass/volume percentage of agarose gel is 1.2% that means 1.2 g of agarose gel is present in 100…

Q: All amino acids have two ionizable functional groups: an α‑amino group (average pKa of 9.4) and an…

A: The question is based on the concept of amino acids. we have to identify at which pH, this structure…

Q: Differentiate and explain the chemical basis of the Kjeldahl, Lowry and Bradford techniques that can…

A: Proteins are essential macromolecules in all living organisms, and their quantification is critical…

Q: Question 2. While internal cysteine amino acid sidechains in proteins undergo oxidation to produce…

A: In conclusion, Ellman's reagent effectively detects free thiols in proteins by reacting with them to…

Q: 26 I low will the e.m.f vary upon the addition of more water to the left hand electrode? (A)…

A: These question are from different different sections of chemistry. First one is related to…

Q: Among these protein assays, which work in acidic conditions? a. Biuret assay b. Bicinchoninic acid…

A: Biuret assay works in alkaline medium, with the help of sodium potassium tartrate, it react with…

Q: Modify isoleucine to show its structure at pH 1 and pH 13. Modify each amino acid by adding or…

A: Detail description is given below

Q: Which of the following amino acids is most likely to have a positively-charged side group under…

A: The physiological pH is 7.4

Question

Outline the steps used to find values for a
BLOSUM amino acid similarity matrix.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps with 2 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

Determine the buffer capacity of Alanine and Histidine at pH 2.0 and 6.0 respectively and discuss the results.
Differentiate and explain the chemical basis of the Kjeldahl, Lowry and Bradford techniques that can be used to quantitate proteins in quality control and research.
At what distances do hydrogen bonding, hydrophobic interactions and charge transfer interactions act to dominate the interactions between particles when at the isoelectric point? The options are Short range or Long range.
. What is the molecular basis for the observation that the overall charge on a protein becomes increasingly positive as pH drops and more negative as pH increases?
1. Calculate the Coulombic (ionic) interaction energy between atoms for the C=O ∙∙∙H-N hydrogen bond in a peptide at a distance of 1.5Å in units of kJ/mol. Assume that the partial charge on O is −0.434, the partial charge on H is +0.417 and the permittivity of the protein environment is 6. coulimbic interaction energy= 27.95 kJ/mol 2. The dipole moment of an individual peptide group is approximately 3.46 D. Assuming that the dipoles line up linearly estimate the energy of interaction (in kJ.mol) of the hydrogen bond in Q1 using a dipole-dipole model. *******please answer #2**********
The -helical parts of myoglobin and other proteins stop whenever a proline residue is encountered in the chain. Why is proline never present in a protein helix?
What are the units of an amount taken as a log. For instance, we were asked to plot a standard curve of the log of the molecular weight of an enzyme vs its migration distance. What is the unit for the log of the molecular weight if the molecular weight was in kDa? We were told to think of pH is measured and what the units are like for that
Consider an amino acid with the following pKa values: pKa1 = 2.71 and pKa2 = 9.31 At what pH value in aqueous solution would this amino acid (its predominant form) exist as an anion?
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
Explain the differences between semi-empirical and ab initio methods of electronic structure computation.
Some Protein P binds to 1 molecule of X. The fractional binding curve (θ vs. [Ligand]) shows that θ = ⅓ when [X] = 6 mM. What is the Kd for X binding to P?
Question 2. While internal cysteine amino acid sidechains in proteins undergo oxidation to produce disulfide crosslinks that stabilize the protein structure after folding, solvent-exposed cysteine sidechains can remain in their reduced thiol form and serve as reactive nucleophiles (recall for instance Acyl Carrier Proteins involved in fatty acid biosynthesis or various oxidoreductase enzymes). The reactive thiol groups in proteins can be detected using Ellman's test, wherein the protein is reacted with a disulfide Ellman's reagent to form a new mixed disulfide and a 2-nitro-5-thiobenzoate (TNB) byproduct. Upon addition of base, TNB is deprotonated to form a dianion, which absorbs light in the visible region and can be detected using UV-Vis spectroscopy. Ellman's Reagent CO₂H -NO₂ internal disulfide crosslink O₂N- HO₂C SH solvent- exposed thiol UV Absorbance at 412 nm O₂N- -S TNB²- alkaline pH O₂N- SH HO₂C 2-nitro-5-thiobenzoate (TNB) -NO2 mixed disulfide CO₂H a) Provide a detailed…