**Question 1:**A) Explain this statement, “Most enzymes are gene-encoded proteins, but most enzymes are not only protein.”B) You recently isolated a new enzyme in your lab, and you named it “lipidase 1120”. As a temporary name, this is fine. Who is responsible for assigning a formal name, and on what criteria will that name be assigned?**Explanation:**A) The statement indicates that while enzymes are primarily proteins synthesized based on genetic instructions, they often have cofactors or coenzymes that are necessary for their catalytic activity. These additional components can be metal ions or organic molecules, making the enzyme a holoenzyme (an active enzyme with its non-protein components).B) The responsibility for assigning a formal enzyme name lies with the International Union of Biochemistry and Molecular Biology (IUBMB), which uses a systematic method to ensure each enzyme’s function and characteristics are clearly defined. Names are typically based on the reactions they catalyze and conform to specific nomenclature rules set by the IUBMB.

Enzymes are the catalysts, which are composed of proteins. They help in enzyme catalysis, in which…

1. A) Explain this statement, “Most enzymes are gene-encoded proteins, but most enzymes are not only protein". B) You recently isolated a new enzyme in your lab, and you named it “lipidase 1120". As a temporary name, this is fine. Who is responsible for assigning a formal name, and on what criteria will that name be assigned?

1. A) Explain this statement, “Most enzymes are gene-encoded proteins, but most enzymes are not only protein". B) You recently isolated a new enzyme in your lab, and you named it “lipidase 1120". As a temporary name, this is fine. Who is responsible for assigning a formal name, and on what criteria will that name be assigned?

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Similar questions

7. Please help answer this question and please show all work on how you got the answers. Thank you so much!! :)
Last week in lab you plated various E. coli mutants. This week we will be analyzing those plates. To help interpret those results, predict the growth/color pattern you'd expect for a Lacz- mutant. Table 1: Options are blue or white for NA plates; Table 2: Options are: growth or none for minimal plates). Table 1 [Select] Table 2 [Select] Xgal glucose Xgal + lactose [Select] [Select] Minimal lactose ΝΑ [Select] Xgal + IPTG [Select] maltose > [S
Name two enzymes/protein complexes in molecular biology that contain both RNA and protein. What processes are they involved in?
The phosphate group furthest from the sugar in a nucleotide is the phosphate --- Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. a a) alpha b) beta c) gamma d d) none of the above
The GC content of the DNA in the genome of a newly discovered bacterium is 46%, what is the percentage of Thymine in the genome this organism?
Cystic fibrosis (CF) is an inherited disorder caused by different types of mutations, many of which prevent ions from moving across cell membranes. Normally there are channel proteins that allow passage of the ions, but in patients with one kind of CF these proteins seem odd. Closer examination shows that these proteins display the correct amino acid sequence. However, they fail to do their job. A) Given that the primary structure of the protein is correct, what can you infer about the DNA sequence for the gene coding this protein on this patient, is there a mutation? Explain. B) Why is the primary structure insufficient to guarantee the proper function of the protein?
The Shine-Dalgarno sequence binds to sequence within the large ribosomal subunit so that ribosomes can properly assemble. The parameter that will definitely differ between an enzyme-catalyzed reaction and the corresponding uncatalyzed reaction is the free energy difference between products and reactants.
Changing only the R-group on a penicillin-family antibiotic could have many consequences. Which of the following possibilities is LEAST likely? Changing the R-group on a penicillin-family antibiotic would cause it to become a protein-synthesis inhibitor. Changing the R-group on a penicillin-family antibiotic would increase the half-life of the drug. Changing the R-group on a penicillin-family antibiotic would make a version that is more effective at killing Gram negative cells. Changing the R-group on a penicillin-family antibiotic would change the dosage that you would give a patient.
1) You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide |protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280nm? Select the best answer. a) Measuring absorbance at higher wavelengths, like 595nm or 562nm, is more accurate than measuring absorbance at 280nm. b) The Bradford…
A researcher creates random copolymers of three nucleotides each by mixing polynucleotide phosphorylase with guanine and adenine nucleotides in a ratio of 5 guanine nucleotides to 1 adenine. Give the different copolymers produced and their theoretical proportions.
13) A researcher is studying the synthesis of a specific amino acid found in Neurospora. She knows that the pathway begins with a precursor that is converted into the amino acid with two known intermediates (Substance Blue and Substance Green). She accurately predicts that this amino acid synthesis pathway is catalyzed by three enzymes, (I, II, and III). She subsequently identifies three mutants that she calls Mutant I, Mutant II, and Mutant III. With the information about the mutants 13) below place the enzymes in the order that the enzymes act in this pathway. (Note: the numbers I, II, don't necessarily indicate the order in which the enzymes appear.) Mutant I (only Enzyme I is mutated) is unable to synthesize the amino acid even if she provided the mutant with both Substance Blue and Substance Green. Mutant II (only Enzyme II is mutated) is able to synthesize the amino acid if she provided the mutar Substance Blue or Substance Green. Mutant III (only Enzyme III is mutated) is able…
Consider an amino acid sequence: D1-G2-M3-E4-C5-A5-F7-H8-R9-I10-A11-H12-T13-Y14-G15-F16-P17-E18-A19-A20-M21-C22-K23-W24-E25-A26-Q27-P28 The β-turn structure is likely found at (Write down the residue number). A possible disulfide bond is formed between the residues and . The total number of basic residues are The addition of chymotrypsin will result in blank peptide fragment(s). The addition of trypsin will result in blank peptide fragment(s). The addition of CNBr will result in blank peptide fragment(s).