. In the early days of ribosome research, before the exact role of ribo-somes was clear, a researcher made the following observation. Shecould find, in sedimentation experiments on bacterial lysates, notonly 30S, 50S, and 70S particles but also some particles that sedi-mented at about 100S and 130S. When she treated such a mixturewith EDTA, everything dissociated to 30S and 50S particles. Uponadding divalent ions, she could regain 70S particles, but never 100Sor 130S particles.(a) Suggest what the 100S and 130S particles might represent, inlight of current knowledge of protein synthesis. What important dis-covery did the researcher miss?(b) Why do you think reassociation to 100S and 130S particles didnot work?

(a) The particles 100S and 130S denote the dimers or trimers of the 70S ribosome subparts. It is…

Answered: . In the early days of ribosome…

Biochemistry

6th Edition

ISBN:9781305577206

Author:Reginald H. Garrett, Charles M. Grisham

Publisher:Reginald H. Garrett, Charles M. Grisham

Chapter30: Protein Synthesis

Section: Chapter Questions

Problem 8P

See similar textbooks

Similar questions

2. pBR3322, an artificially made plasmid, is shown below. ECORI Hindill BamHI Pstl Amp ORI ↓↓ Tetr pBR322 (4.36 kb) ↑ Pvull Xmalll Describe 3 features that this plasmid has and indicate each one on the diagram. i) ii) 111]
BIOCHEMISTRY Complete the series for DNA replication, transcription and translation by writing the complementary DNA strand, mRNA, tRNA and series of amino acid. Using the table given, write the hidden message on the space provided:
Microtubules both in vitro and in vivo undergo dynamic instability, and this type of assembly is thought to be intrinsic to the microtubule. What is the current model that accounts for dynamic instability?
Which of the following sequences correctly lists in order the steps involved in the incorporation of a proteinaceous molecule within a cell? protein synthesis of the protein on the ribosome; modification in the Golgi apparatus; packaging in the endoplasmic reticulum; tagging in the vesicle synthesis of the protein on the lysosome; tagging in the Golgi; packaging in the vesicle; distribution in the endoplasmic reticulum synthesis of the protein on the ribosome; modification in the endoplasmic reticulum; tagging in the Golgi; distribution via the vesicle synthesis of the protein on the lysosome; packaging in the vesicle; distribution via the Golgi; tagging in the endoplasmic reticulum
Melanosomes are specialized lysosomes that storepigments for eventual release by exocytosis. Various cellssuch as skin and hair cells then take up the pigment, whichaccounts for their characteristic pigmentation. Mousemutants that have defective melanosomes often have paleor unusual coat colors. One such light-colored mouse, theMocha mouse (Figure Q13–3), has a defect in the gene forone of the subunits of the adaptor protein complex AP3,which is associated with coated vesicles budding from thetrans Golgi network. How might the loss of AP3 cause adefect in melanosomes?
1) Antibiotic-resistance is one of the gravest dangers to the world’s medical system. As a result, Dr. Jhon Peῆa decides to apply for a research grant from the NIH to investigate novel targets for antibiotic treatment in his lab. Most bacteria have developed resistance to counter the effects of the current crop of antibiotics, which largely target the cell wall, plasma membrane, or ribosomes. Dr. Peῆa’s team has instead been investigating bacterial transcriptional sites and all of his students are asked to attend a group Zoom meeting to discuss ideas to put into the grant. The lab technician, Jazmin, wonders if anyone thought of blocking the entrance way to the ribosome, the translator of mRNA? What does the rest of the lab think? a Considering the grant is for transcriptional targets, this makes no sense. b This makes perfect sense since the bacterial ribosome has a different structure than the eukaryotic ribosome, which everyone learns in Intro Bio in their…
For any antibiotic compounds that don’t appear to inhibit translation of proteins from the ribosome, purpose another potential mechanism whereby this class of antibiotic might be able to act (outside of cell wall/membrane formation). Explain in deatil.
:) Choose the statement that correctly explains how an antibiotic that inhibits protein synthesis can be selective. A) Antibiotics bind to the 70S bacterial ribosomes but not to the 80S eukaryotic und al ribosomes. New Hod B) Eukaryotic cells are impermeable to these antibiotics so the antibiotics cannot enter them. 2) 13) 3) 4) C) Eukaryotic cells inactivate these antibiotics. D) Antibiotics prevent the synthesis of bacterial tRNAs but not eukaryotic tRNAs. Infection occurs when A) a person swallows microbes in/on food B) contaminants are present on the skin C) pathogens enter and multiply in body tissues D) a person inhales microbes in the air E) All of the choices are correct. niopmolds bas onszentr anotostat luniy (8 moitetai neosolong ( moitostai legat (C exoitootmi ovilegon-mang (3 Ampicillin, amoxicillin, mezlocillin, and penicillin G all A) target the cell wall B) have an expanded spectrum of activity C) have resistance to the action of penicillinase server ingrat at egub…
Eukaryotic cells have a ribosome. a) 60S; 70S b) 70S; 80S c) 80S; 70S d) 70S; 60S _size ribosome, while prokaryotic cells have a size
1）picture1: what bond is this between cytosine and ribose？ 2）picture2 ： what bond is that bewteen phosphate and ribose？ 3）charged tRNA formed when amino acids connect to tRNA through ester bond. Draw the ester bond example please？
Proteins like channels embedded within the cell's plasma membrane and enzymes scattered in the cytoplasm carry out vital functions. Can you explain the steps of the biological process, allowing cells to make proteins from genes? Can you please provide as many details to each step?
1. You are working on identifying novel proteins associated with the plasma membrane and you isolate XYZ1. Protein sequencing shows XYZ1 is comprised of: MGASSCSELRSSAFALSERSDKSSAVLLIVLGVMAVGIYLLVTMVLIIGTSANRASGSKD SESMSTLECAAPNDSAA a. Based on the sequence. Do you predict this is a peripheral membrane protein or an integral membrane protein? (Hint: use the Hydropathy plot generator on Expasy using default settings to help answer this question.) b. You decide to conduct an experiment to further assess how the protein is connected to the PM. The experiment is conducted by either 1) treating intact cells with chymotrypsin, 2) by disrupting the plasma membrane such that chymotrypsin has access to both sides of the plasma membrane, or 3) by using detergents to remove all lipid bilayers and treating the proteins such that chymotrypsin will have access to -Chym. Cond. 1 - +Chym. Cond. 2 Cond. 3 the entire length of the protein. The treatments are run on an SDS-PAGE gel (together with an…

SEE MORE QUESTIONS

Recommended textbooks for you

Biochemistry

ISBN:

9781305577206

Author:

Reginald H. Garrett, Charles M. Grisham

Publisher:

Cengage Learning

Biology 2e

Biology

ISBN:

9781947172517

Author:

Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:

OpenStax

Biology (MindTap Course List)

Biology

ISBN:

9781337392938

Author:

Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Publisher:

Cengage Learning

Biochemistry

ISBN:

9781305577206

Author:

Reginald H. Garrett, Charles M. Grisham

Publisher:

Cengage Learning

Biology 2e

Biology

ISBN:

9781947172517

Author:

Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:

OpenStax

Biology (MindTap Course List)

Biology

ISBN:

9781337392938

Author:

Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Publisher:

Cengage Learning

Human Heredity: Principles and Issues (MindTap Co…

Biology

ISBN:

9781305251052

Author:

Michael Cummings

Publisher:

Cengage Learning

SEE MORE TEXTBOOKS