Concepts of Genetics (12th Edition)
12th Edition
ISBN: 9780134604718
Author: William S. Klug, Michael R. Cummings, Charlotte A. Spencer, Michael A. Palladino, Darrell Killian
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 5, Problem 24PDQ
Traditional gene mapping has been applied successfully to a variety of organisms including yeast,
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
When the S.cerevisiae genome was sequenced and surveyed for possible genes, only about 40% of those genes had been previously identified in forward genetic screens. This left about 60% of predcited genes with no known function, leading some to dub the genes fun (function unknown) genes.
a)As an approach to understanding the function of a certain fun gene, you wish to create a loss of function allele. How would you do this?
b)You wish to know the physical location of the encoded protein product. How would you obtain such information?
Should the exposome field focus exclusively on measuring chemicals derived from exogebeous sources or should the field also evaluate the chemicals generated and processed from endogeneous sources?
If a study of the human genome gave rise to genomics, does the human exposome give rise to a new field of exposomics?
Common bean (Phaseolus vulgaris L.) is a legume deficient of an essential amino acid methionine while wheat (Triticum aestivum) is rich in lysine. Common bean crop needs to be fortified for nutritional improvement using genetic engineering. What could be the best transformation method for transfer of that particular set of genes in to common bean genome. Elaborate some conventional and non-conventional methods that could be used
Chapter 5 Solutions
Concepts of Genetics (12th Edition)
Ch. 5 - In a family with one autistic child the risk for...Ch. 5 - Given that the prenatal test can provide only a...Ch. 5 - Consider two hypothetical recessive autosomal...Ch. 5 - With two pairs of genes involved (P/p and Z/z), a...Ch. 5 - In Drosophila, a heterozygous female for the...Ch. 5 - HOW DO WE KNOW? In this chapter, we focused on...Ch. 5 - Review the Chapter Concepts list on page 94. Most...Ch. 5 - Describe the cytological observation that suggests...Ch. 5 - Why does more crossing over occur between two...Ch. 5 - Explain why a 50 percent recovery of...
Ch. 5 - Why are double-crossover events expected less...Ch. 5 - What is the proposed basis for positive...Ch. 5 - What two essential criteria must be met in order...Ch. 5 - The genes dumpy (dp), clot (cl), and apterous (ap)...Ch. 5 - Colored aleurone in the kernels of com is due to...Ch. 5 - In the cross shown here, involving two linked...Ch. 5 - In a series of two-point mapping crosses involving...Ch. 5 - Two different female Drosophila were isolated,...Ch. 5 - In Drosophila, a cross was made between femalesall...Ch. 5 - Another cross in Drosophila involved the...Ch. 5 - In Drosophila, Dichaete (D) is a mutation on...Ch. 5 - Drosophila females homozygous for the third...Ch. 5 - In Drosophila, two mutations, Stubble (Sb) and...Ch. 5 - If the cross described in Problem 18 were made,...Ch. 5 - Are mitotic recombinations and sister chromatid...Ch. 5 - What possible conclusions can be drawn from the...Ch. 5 - An organism of the genotype AaBbCc was testcrossed...Ch. 5 - Based on our discussion of the potential...Ch. 5 - Traditional gene mapping has been applied...Ch. 5 - DNA markers have greatly enhanced the mapping of...Ch. 5 - In a certain plant, fruit is either red or yellow,...Ch. 5 - Two plants in a cross were each heterozygous for...Ch. 5 - A number of humanmouse somatic cell hybrid clones...Ch. 5 - A female of genotype produces 100 meiotic tetrads....Ch. 5 - In laboratory class, a genetics student was...Ch. 5 - Drosophila melanogaster has one pair of sex...Ch. 5 - In Drosophila, a female fly is heterozygous for...Ch. 5 - The gene controlling the Xg blood group alleles...Ch. 5 - Prob. 34ESP
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSParrow_forwardDo all of them True/False 31) The process by which an electrical charge is used to introduce DNA into a cell to produce a transgenic organism is called electroporation.Answer: 32) Reproductive cloning is used to produce large amounts of mammalian proteins from transgenic agricultural animals such as cattle.Answer: 33) In gene addition, homologous recombination is used to remove the original gene and replace it with the cloned gene.Answer: 34) All stem cells have the potential to differentiateAnswer: 35) A bone marrow transplant involves the transfer of multipotent stem cellsAnswer: 36) The fact that in mammalian systems multiple genes may compensate for the loss of a gene is called gene redundancy.Answer:arrow_forwardWhat is inverse PCR? How are we going to use inverse PCR to help figure out the molecular location of the EP element on Drosophila melanogaster flies?arrow_forward
- With the many high throughput experiments that are used in biomedical research, how are some ways to integrate those datasets using systems biology? For example, if you had a microarray dataset that annotated gene expression levels and a proteomics dataset that identifed protein interactions, how could you jointly use both datasets to identify markers for a disease? Explain each step.arrow_forwardYou just graduated from college and started working at a biotech startup called Scrofabulous. Your first job assignment is to clone the pig gene for the hormone prolactin. Assume that the pig gene for prolactin has not yet been isolated, sequenced, or mapped; What would be the most useful and economical first step to go about identifying and cloning the pig gene for prolactin? use the amino acid sequence of mouse prolactin to design a pair of degenerate oligonucleotide PCR primers to PCR-amplify the pig prolactin gene. RNAseq the pituitary gland of the pig, the most abundant gene is likely to to be prolactin Conduct a proteome search for peptides that match parts of mouse prolactin protein Sequence the pig genome, then translate the genome to find the gene predicted to encode for prolactin Crystalize the mouse prolactin protein and use Google's DeepMind Al to find the closest amino acid sequence in the pig proteomearrow_forwardForward Genetics Analysis uses a variety of beneficial approaches to identify never before described genes. For each of the following approaches or outcomes, briefly (maximum 2 sentences) discuss in your own words, their purpose in Forward Genetics Analysis. c) Mendelian ratios d) Genetic screenarrow_forward
- How can you assess dominance and mapping with only one mutant?arrow_forwardWhat are some possible research questions and practical applications that could be addressed by creating organisms with artificial chromosomes and synthetic genomes? What might be some potential safety, environmental, social, and ethical concerns about creating organisms with synthetic genomes?arrow_forwardAlthough a number of different animals have been successfully cloned, the process of creating cloned animals is very inefficient. Typically, only about 0.1% to 3% of attempts result in a live-born animal. What might be some of the reasons for this low rate of success?arrow_forward
- Bioinformatics is an interdisciplinary field that integrates knowledge of computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (1) What does BLAST stand for? (ii) Explain the function of BLAST.arrow_forwardIncreasingly, whole-genome sequencing of individuals is being done to help identify and treat medical conditions. Genome sequencing invariably identifies a number of variations, some common and some rare, that might be clinically relevant. For example, suppose a person had their genome sequenced to help determine their risk for cardiovascular disease and, just by chance, the sequence revealed that they carry one or more variants that predispose them to cancer or Alzheimer disease. Does the sequencing laboratory or physician have an obligation to report this finding, which was not the purpose of the sequencing and which the patient did not request? What about reporting variants for which no or limited information can be provided about their clinical significance? Does the answer to this question differ for sequencing done on children?arrow_forwardIllustrate about the Map and sequence the genomes of several model organisms used in experimental genetics, including Escherichia coli, Saccharomyces cerevisiae, Caenorhabditis elegans, Drosophila melanogaster, and Mus musculus (mouse).arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSONBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxAnatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
- Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & CompanyLaboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education
Molecular Techniques: Basic Concepts; Author: Dr. A's Clinical Lab Videos;https://www.youtube.com/watch?v=7HFHZy8h6z0;License: Standard Youtube License