Concept explainers
To determine: Whether an individual would sequence its genome if the price is affordable or not along with an explanation.
Introduction: The genome is the genetic material that is present in an organism. It consists of deoxyribonucleic acid. The genome consists of genes, noncoding DNA, mitochondrial DNA, and chloroplast DNA.
To determine: Whether a person makes its genome sequence publicly available or not.
Introduction: DNA is a molecule which is composed of two chains of sugar-phosphate. These chains are coiled around each other to form a double helix structure. DNA consists of
To determine: The ways by which the sequenced genome can be misused.
Introduction: A gene is the basic functional unit of heredity. Genes are located on a chromosome. The function of a gene is to control the development of one or more traits.
Want to see the full answer?
Check out a sample textbook solutionChapter 22 Solutions
Concepts of Genetics (11th Edition)
- If you were offered the chance to have the genome of your newborn sequenced at a cost of 1,000, would you do so?arrow_forwardExplain why exome sequencing can be almost as valuable as genome sequencing. (Explain in your own words)arrow_forwardIf “the human genome sequence” does not really exist, can you think of better ways in which we might represent the human genome? Propose some possibilities.arrow_forward
- What does the future hold for genomes? How will they be different in 100, 1,000, 1 million, or 1 billion years? Make this a long discussion.arrow_forwardhttps://www.khanacademy.org/science/biology/biotech-dna-technology/dna-cloning-tutorial/a/overview-dna-cloning That is the link for the example ^arrow_forward7) The Human Genome project cost billions of dollars to complete. What was it and do you think it was worth the cost? Use at least two lines of reasoning to support your opinion.arrow_forward
- Suppose that a human genomic library is prepared by exhaustive digestion of human DNA with the EcoRI restriction enzyme. Fragments averaging about 4 kb in length would be generated. Is this procedure suitable for cloning large genes? Why or why not?arrow_forwardYou just graduated from college and started working at a biotech startup called Scrofabulous. Your first job assignment is to clone the pig gene for the hormone prolactin. Assume that the pig gene for prolactin has not yet been isolated, sequenced, or mapped; What would be the most useful and economical first step to go about identifying and cloning the pig gene for prolactin? use the amino acid sequence of mouse prolactin to design a pair of degenerate oligonucleotide PCR primers to PCR-amplify the pig prolactin gene. RNAseq the pituitary gland of the pig, the most abundant gene is likely to to be prolactin Conduct a proteome search for peptides that match parts of mouse prolactin protein Sequence the pig genome, then translate the genome to find the gene predicted to encode for prolactin Crystalize the mouse prolactin protein and use Google's DeepMind Al to find the closest amino acid sequence in the pig proteomearrow_forwardLet’s suppose you are in charge of organizing and publicizing a databasefor the mouse genome. Make a list of innovative strategies you wouldinitiate to make the mouse genome database useful and effective.arrow_forward
- What is expected theoretical number of copies of DNA molecules after 28 cycles in a PCR experiment? What is the percent efficiency of the PCR experiment if the actual number of copies was 500,000,000? Show your calculationsarrow_forwardBioinformatics is an interdisciplinary field that integrates knowledge of computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (1) What does BLAST stand for? (ii) Explain the function of BLAST.arrow_forwarda) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSParrow_forward
- Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage LearningHuman Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningConcepts of BiologyBiologyISBN:9781938168116Author:Samantha Fowler, Rebecca Roush, James WisePublisher:OpenStax College