Campbell Biology, Books a la Carte Plus Mastering Biology with eText -- Access Card Package (10th Edition)
10th Edition
ISBN: 9780133922851
Author: Jane B. Reece, Lisa A. Urry, Michael L. Cain, Steven A. Wasserman, Peter V. Minorsky, Robert B. Jackson
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Question
Chapter 20.4, Problem 3CC
Summary Introduction
To determine: The lab tests and its results to rule out the presence of hepatitis A infection in the given patient.
Concept introduction:
To detect a known RNA sequence, methods such as reverse transcriptase polymerase chain reaction (RT-PCR) or RNA sequencing can be used. In both the cases, mRNA is first converted to complementary DNA (cDNA) and then analyzed. Hepatitis A is categorized as an RNA virus. Hepatitis A infection can be detected in the blood or tissue through these methods.
Expert Solution & Answer
Trending nowThis is a popular solution!
Students have asked these similar questions
The genetic material of virus includes(a) only RNA.(b) only DNA.(c) RNA and DNA both(d) RNA or DNA , i.e., one nucleic acid in a virus.
Please try to break the solutions into as many steps as practically possible and the steps should come one by one and they should be short and crisp and plagiarism-free.
1. Precise words:Find the nonspecific terms in the following sentences. Replace the nonspecific choices with more preciseterms or phrases (It is not necessary to change the sentence structure).(i) All OVE mutants showed enhanced iP concentrations.(ii) Plants were kept in the cold overnight.(iii) To provide proof of concept for our hypothesis, we studied a virus in its host cell.(iv) The present paper reports on continuing experiments that were performed to clarify thissurprising effect.(v) The first transition state is a little lower in energy than the second transition state.
2. Simple words:Improve the word choice in the following examples by replacing the underlined terms or phrases withsimpler word choices (do not change the sentence structure).(i) These data substantiate our hypothesis.(ii) The difference in our results compared to those of Reuter et al. (1995) can be accounted forby the fact that different conditions were used.(iii) For the purpose of discussing cell migration we…
I need the answer as soon as possible
Chapter 20 Solutions
Campbell Biology, Books a la Carte Plus Mastering Biology with eText -- Access Card Package (10th Edition)
Ch. 20.1 - Prob. 1CCCh. 20.1 - Prob. 2CCCh. 20.1 - What are some potential difficulties in using...Ch. 20.1 - Prob. 4CCCh. 20.2 - Prob. 1CCCh. 20.2 - Prob. 2CCCh. 20.3 - Based on current knowledge, how would you explain...Ch. 20.3 - Prob. 2CCCh. 20.3 - Prob. 3CCCh. 20.4 - What is the advantage of using stem cells for gene...
Ch. 20.4 - Prob. 2CCCh. 20.4 - Prob. 3CCCh. 20 - Describe how the process of gene doning results in...Ch. 20 - What useful Information is obtained by detecting...Ch. 20 - Describe how, using mice. a researcher could carry...Ch. 20 - What factors affecf whether a given genetic...Ch. 20 - In DNA technology, the term vector can refer to...Ch. 20 - Which of the following tools of DNA technology is...Ch. 20 - Prob. 3TYUCh. 20 - A paleontologist has recovered a bit of tissue...Ch. 20 - Prob. 5TYUCh. 20 - Which of the following is not true of cDNA...Ch. 20 - Expression of a cloned eukaryotic gene in a...Ch. 20 - Which Ii of the following sequences in...Ch. 20 - Prob. 9TYUCh. 20 - Prob. 10TYUCh. 20 - EVOLUTlON CONNECTION Ethical considerations aside,...Ch. 20 - Prob. 12TYUCh. 20 - Prob. 13TYUCh. 20 - The water in the Yellowstone National Park hot...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Coronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a…arrow_forwardHelllo, Im confused how to do this problem, can you give an explanation too?arrow_forwardAfter consulting table , what additional facts can you stateabout viruses, especially as compared with cells?arrow_forward
- Note: Dont use guideline answer dont use extra explanation. Just solve full accurate and full accurate ok. With diagrams 1. Describe two methods that are utilized to obtain a high-resolution image of a virus particle structure. And compare the pros and cons of the two methods.arrow_forwardA virus that has which type of genome must carry replicase within the viral particle? (choose all that apply) ds DNA ss (+) DNA ss (–) DNA ss (+) RNA ss (–) RNA Which viral type has a genome that can be directly translated? (choose all that apply) ds DNA ss (+) DNA ss (–) DNA ss (+) RNA ss (–) RNAarrow_forwardjust answer question --- dont need explanationarrow_forward
- We’re starting to understand the mysterious surge of hepatitis in children (MIT Technology Review 07/25/22) Hundreds of young children around the world have developed severe cases of hepatitis with no obvious cause, leaving doctors baffled. But two new studies reveal the potential culprits: a combination of genetic factors, lockdowns, and at least two viruses working together. Doctors first noticed a strange cluster of hepatitis cases in young children in Scotland in April this year. By April 8, 60 cases were being investigated across Scotland, England, and Wales, mostly in children aged two to five. As of July 8, the World Health Organization reported 1,010 probable cases of the liver condition in 35 countries—although the true number is likely to be higher, says Antonia Ho, an infectious diseases consultant at the MRC–University of Glasgow Centre for Virus Research, who has been investigating the outbreak. A third of the cases reported so far have been in the US. These cases are…arrow_forwardWhy do some hepatitis B virus infected cells contain multiple copies of the same hepatitis B virus genome? Thank you!arrow_forwardGive detailed Solution with explanation needed (don't copy the answer other sitearrow_forward
- Which statements are accurate regarding properties of viruses? Select allthat apply. a. Viruses are cell structures that are compact and economical.b. Viruses represent active molecules outside the host cell.c. The basic structure of a virus is composed simply of a protein shell.d. Viruses do not contain enzymes for most metabolic processes.e. Viruses contain either DNA or RNA.arrow_forwardAre viruses living? Discuss based from the properties of life in Biology.arrow_forward1. Pandoravirus salinus is virus that infects amoeba, is very large (1µm) and has a genome composed of double-stranded DNA that is 2.47 Mbp in size (247,000,000 bp). P. salinus has genes not typically associated with viruses, such as genes required for the synthesis of amino acids. In what ways might this force virologists to re-examine the definition of virus?arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSON
Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Anatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education