Q: 19. Describe the comparator activities of the cerebellum.
A: Introduction The cerebellum is an important component of the hindbrain of all vertebrates. In some…
Q: In terms of function when a presynaptic neuron receiving input from a nearby inhibitory neuron,…
A: After a signal molecule binds to the cell receptor, a sequence of conformational changes occurs. The…
Q: How are the "types ot veterbrae" modified in birds, relative to other amniotes?
A: Many variables influence the survival or extinction of an organism's population. On the other hand,…
Q: Differentiate the Cimex sp. versus Ixodes sp. based on their morphology, ecology and/or behavior
A: Introduction: Insecta is an important class of the phylum Arthropoda. Some of their characteristics…
Q: You find that in a population of a butterfly species that that the frequency of allele 1 at the…
A: Hardy-Weinberg Equilibrium the formula is --- p² + 2pq+ q²= 1 p² = dominant homozygous frequency q²…
Q: Are viruses living? Discuss based from the properties of life in Biology
A: It's been suggested that viruses are neither living things nor inanimate objects. This is due to the…
Q: Discuss the different methods of measuring onions and citrus physical characteristics/properties and…
A: Onion and lemon are two of the most important agricultural product in the globe. These two also fall…
Q: Question 1 In a population of 450 rats, birth rate of 60 rats and death rate 15 rats was recorded in…
A: Introduction: a)Birth rate.the proportion of live births per 1,000 people each year. b)Death…
Q: Are viruses living? Discuss based from the properties of life in Biology.
A: Viruses are infectious agents possesssing both living and non living characteristics.Their living…
Q: 4) Which is the correct flow of air containing oxygen to the lungs? A.…
A: Introduction: The network of organs and tissues that makes up the human respiratory system aids in…
Q: Label whether the following are genotypes or phenotypes: a. Aa b. Tall plants c. BB d. Abnormal cell…
A: Introduction The study of genes and heredity, or how particular characteristics or traits are…
Q: Which of the following processes and or mechanisms of evolution violate the assumptions of…
A: A population must satisfy five key suppositions in order to be in Hardy-Weinberg equilibrium, or a…
Q: A membrane potential (Vm) labeled axis on the graph In the graph draw the phases of the action…
A: Introduction Action potentials, those electrical impulses that go throughout your body, are nothing…
Q: All can be said of dendrites, EXCEPT: they must grow in size to be able to "learn" undergo…
A: Dendrites are finger-shaped cells located at the end of each neuron. The dendrites are small but…
Q: The largest cycloneuralians are also the only ones with external fertilization. Which phylum is…
A: * Cycloneuralians belongs to the clade of ecdysozoan animals which consists of Scalidophora and…
Q: Solar-induced fluorescence can be used to infer net photosynthesis. This is because this…
A: Introduction : Plants can synthesize their own energy from sunlight through a process known as…
Q: Which arrow in the diagram of transcription below is labeling the 'SENSE DNA strand? Note that the…
A: In genomics, transcription is the process of creating an RNA copy of a gene's DNA sequence. This…
Q: kame Tissue Type Identification Worksheet A) Identify the following structures as Epithelial,…
A: Epithelial tissue is made up of closely packed cells having thin lining. Connective tissues can be,…
Q: 5. This kingdom consists of the simplest organisms; these organisms can live nearly everywhere O…
A: Introduction Kingdom is ranked just behind domain in the study of taxonomy. The lower levels of…
Q: 14. Eubacteria will display one of three shapes. These shapes CC
A: Bacteria are ubiquitous, mostly free-living organisms often consisting of one biological cell. They…
Q: Classify and characterize the plant-like protists (algae) based on the following parameters.…
A: Note: As Per Guidelines, we can answer 3 sub-parts of a question at one time. Please ask rest…
Q: Review Questions: 1. Matching. Match the letter of the word next to the corresponding definition. A.…
A: Introduction The place an organism holds in a food web determines its trophic level. A food chain…
Q: Please define the term closed circulatory system. Which animals have it, and what are its’…
A: The circulatory system is the system that transports blood, gases, nutrients, wastes, and lymph.
Q: Explain how the following affect membrane fluidity: – Level of phospholipid tail saturation – Level…
A: The thin, living, elastic, semipermeable lipoproteinaceous membrane that is present around the cell…
Q: A certain plant species has dominant red flower color (R) to the recessive white flower color (r). A…
A: Introduction Inheritance is the process of transmitting traits from parent to offspring. The traits…
Q: features that suggest the Cnidaria and Ctenophora share. Outline the features that distinguish these…
A: Cnidaria and Ctenophora are two phyla belonging to the kingdom Animalia. Cnidarians are named so…
Q: What is the importance of the aseptic technique?
A: Microbes are the tiny , microscopic organisms that cannot be visualise as such through naked eyes .…
Q: if you will make a vaccine against SARS-CoV 2 which is the causal agent of COVID 19, how would you…
A: The vaccination provides a harmless, altered form of the virus known as "the vector" to incorporate…
Q: List and briefly explain at least three examples of pseudoscience that are related to or attempt to…
A: Pseudoscience It involves claims made by ideas, practises, or declarations that they are true and…
Q: According to this phylogenetic tree (attached), support for Actinostropbus is a. strong b.…
A: The evolutionary relationship of different species which evolved from the common ancestors and are…
Q: Name the specific names of cells found in blood
A: Introduction Blood and lymph are two fluid connective tissues that flow throughout our…
Q: Aside from using the autoclave, what are other ways to kill microorganisms from glassware that can…
A: * Culture media has to be sterilize before using it. * Sterilization is a process that destroys or…
Q: ANSWER BRIEFLY BUT COMPLETE. ANSWERS MUST BE ORIGINAL AND NOT JUST COPIED ON THE INTERNET. I WILL…
A: The cerebellum is a structure found in the rear of the brain, beneath the occipital and temporal…
Q: A man with type B blood marries a woman with type A blood. They have the first child with blood type…
A: Introduction: Although blood groups refer to antigens on red blood cells, they are actually…
Q: What gene sequences are selected during DNA barcoding?
A: DNA barcoding is a taxonomic technique which identifies at the species level by using a brief…
Q: burger is initially contaminated with 100 cells of bacteria. To solve: How many cells will there…
A: Introduction Bacteria are prokaryotic, unicellular organisms. Bacteria belongs to the Kingdom…
Q: Is most of the light used in the photosynthesis is absorbed by chlorophyll a or b?
A: Photosynthesis is the process by which plants use sunlight, water, and carbon dioxide to create…
Q: What was the order of divergence from oldest (1) to most recent (5)?
A: The accumulation of variations between genetically similar groups within a species that results in…
Q: Explain how the introduction of the Texas panthers affected the biodiversity of the Florida panther…
A: If biodiversity is lost, our ecosystem is more likely to fail, and humans may lose certain imported…
Q: Differentiate the types of necrosis.
A: Introduction : Necrosis is a form of cellular death that takes place when cells are exposed to…
Q: 12. d) noltionos le ter Wonsmo color-blind A red-green man (sex-linked gene) marries a normal woman.…
A: Introduction: Simply said, colour blindness is the inability to see or distinguish between colours…
Q: Based on cell theory, how do new cells arise? O They come from the division of other cells The arise…
A: Introduction :- The scientific idea that cells make up living things, that they are the fundamental…
Q: Which is NOT an example of Incomplte Dominance? EXPLAIN WHY? A. a pink flower
A: Incomplete dominance is When a dominant allele, or form of a gene, only partially overrides the…
Q: Three polypeptides, the sequences of which are represented using the one-letter code for their amino…
A: Introduction :- Ion exchange chromatography (IEX), which separates molecules according to their net…
Q: 15. If a man with blood type B, who has one parent with blood type O, marries a woman with blood…
A: In humans, ABO blood is usually controlled by gene I. The kind of sugar polymer present on the…
Q: 11. Describe the spinal cord gray matter, where are sensory and motor neurons located in the gray…
A: he Brain is the body's largest and most complicated organ, made up of many (>100 billion neurons)…
Q: what are the differences and similarities between LPS and LPS+IL-10?
A: Inflammatory response occurs when any tissue is affected by the foreign materials, such as: trauma,…
Q: 12, Name the three main plexuses and the major nerves derived from each.
A: A nerve plexus is a plexus (branching network) of intersecting nerves. A nerve plexus is composed of…
Q: Which are the organisms in one of the food chains in this food web? Who is the producer in the…
A: In biodiversity, a food chain contains different kinds of organisms from producers to consumers.
Q: For the pedigrees below, name the inheritance pattern of the depicted disorder: If more than one…
A: Introduction : A pedigree chart is a diagrammatic flow chart designed to display a person's genetic…
why is fluid mosaoc model called "fluid mosaic model" ?
Step by step
Solved in 2 steps
- Show solution pls.Gel-filtration chromatography separates molecules according to their size . Smaller molecules diffuse faster in solution than larger ones, yet smaller molecules migrate more slowly through a gel- filtration column than larger ones. explain this paradox. What should happen at very rapid flow rates?1. A recent preprint article e reported pre-clinical evaluations of an inactivated Newcastle disease virus (NDV) chimera stably expressing the membrane-anchored form of the SARS-CoV-2 spike region (NDV-S) as a potent COVID-19 vaccine in mice and hamsters. To design the SF Chimera, researchers combined the transmembrane domain and cytoplasmic tail of NDV F protein with the ectodomain of the SARS-CoV-2 S region, whose sequence is as follows: MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAS TEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKH TPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV…
- B 3:25 PM Wed Feb 8 Acellus national Academy of Science. All Rights Reserved. Diffusion/Osmosis To the left To the right ... ♥CVS Which direction will the water move in this image?SOLUTE EGG MEMBRANE WATER Figure 1. Consider Figure 1. At what % corn syrup solution did we see this scenario? Hint: Think about your answer to the previous question. What happens to the egg in this scenario? 0% corn syrup concentration 10% corn syrup concentration 20% corn syrup concentration 100% corn syrup concentration 76°F PamCell Transport Method Passive or Active Process? Is process used to molecules move DOWN their concentration gradient, AGAINST their concentration gradient, or to move LOTS of a molecule at once? I= Definition
- how many ml of sterile water injection must be mixed with two 4 ml vials of sterile hypertonic NaCl 7% USP to make the mixture isotonic? pharTell me the type of transport based on the following diagramsA Lab Data Did you correctly calculate the diffusion rate? Time (min) 10 20 30 Time (min) 0-10 0-20 0-30 Diffusion Spot Diameter 1 Crystal (mm) 15 15 18 Rate of Diffusion for 1 Crystal (mm/hr) 90 45 36 Diffusion Spot Diameter 3 Crystals (mm) 0-15 0-15 0-18 Rate of Diffusion for 3 Crystals (mm/hr) 270 135 108 How to Measure Diffusion Spot Diameter 6 Crystals (mm) 0-15 0-15 0-18 Rate of Diffusion for 6 Crystals (mm/hr) 540 270 216 Rate [mm/h] = (diameter [mm] / time [min]) x 60 [min - X V LABELS