Viruses are nonpolar due to their lipid membrane. Water is polar. Soap is a surfactant, which means it may combine polar and nonpolar molecules. As a result, how can we emphasize the importance of soap in the fight against COVID?

Viruses are nonpolar due to their lipid membrane. Water is polar. Soap is a surfactant, which means it may combine polar and nonpolar molecules. As a result, how can we emphasize the importance of soap in the fight against COVID?

Curren'S Math For Meds: Dosages & Sol

11th Edition

ISBN:9781305143531

Author:CURREN

Publisher:CURREN

Chapter16: Adult And Pediatric Dosages Based On Body Surface Area

Section: Chapter Questions

Problem 7.2P

See similar textbooks

Similar questions

You are a bacteriologist studying a pathogenic protein (the “BAD” protein) that contributes to diseases caused by Staphylococcus aureus. BAD functions as an ab heterodimer, and the a subunit (25kD) and b subunit (75kD) are held together by an electrostatic interaction between K in the a subunit and D in the b subunit. You are trying to dissociate the BAD subunits to prevent pathogenesis in the bacteria. Which mutation would you make to prevent the BAD subunits from forming a dimer? Assume neutral pH. (A) introduce AAA to AGA point mutation in the a subunit gene(B) introduce GAC to GAG point mutation in the b subunit gene(C) introduce GAT to CGT point mutation in the b subunit gene(D) introduce two point mutations: AAG to GTG in the a subunit gene & GAC to CTC in the b subunit gene (E) introduce two point mutations: AAA to TGC in the a subunit gene & GAT to TGT in the b subunit gene
a typical eukarytic cell has a diameter of 50 microns while a corona virus particles has a diameter of 100 nanometers. how many virus particles could be packed into the volum of the typical eurkaryotic cell? (assume the cell and the virus are spherical - V = 4/3 π R^3 and that the particles can use 100% of the space in the cell)
Both ethanol and trimethyldodecylammonium chloride are active ingredients in cleaning products used to disinfect. Both will inactivate coronaviruses by a similar mechanism of action. Describe that mechanism of action and why both chemicals are able to cause it. (Reminder: coronaviruses are "lipid envelope" viruses.) Consider the physical properties of these compounds to answer the following question: why might you choose to use a cleaning product with one of these active ingredients over the other?
In general, why might cell-wall inhibiting antimicrobial drugs be less effective on gram-negative bacteria compared to gram-positive bacteria? The gram-negative bacteria digest these drugs at a much higher rate than gram-positive bacteria. The mutation rate of gram-negative bacteria is much greater than that of gram-positive bacteria. The outer membrane of the gram-negative bacteria inhibits penetration of the drug. The peptidoglycan found in gram-positive bacteria is structurally different from that in gram-negative bacteria. The gram-negative bacteria do not synthesize peptidoglycan.
Gram staining is a common technique used to differentiate two large groups of bacteria based on their different cell wall constituents. The Gram stain procedure distinguishes between Gram positive and Gram negative groups by coloring these cells red or violet. Gram positive bacteria stain violet due to the presence of a thick layer of peptidoglycan in their cell walls, which retains the crystal violet these cells are stained with. Alternatively, Gram negative bacteria stain red, which is attributed to a thinner peptidoglycan wall, which does not retain the crystal violet during the decoloring process - s. epidermidis a gram-positve coccus - E. coli a gram-negative bacillus - C. xerosis a gram-positive bacillus How does each organism fulfill a specific niche based on the information provided above?
The spike proteins of a coronavirus are one half of the Velcro mentioned in the video, and the other half of the Velcro consists of molecules on the surface of human cells. What happens after coronavirus spike proteins bind to molecules on the surface of a human cell?
Below is the primary sequence of a viral protein. MSVVNTEIKFPTHLRSGDFAIIDGMVVEVTSVEYKPVEQAVYLKYRYHLHGNELSGSSLISAFKAVRTLEVP Does this protein absorb light at 280 nm? If yes, please write (as a number) how many residues contribute to absorbing light at 280 nm. If no, then your answer should be zero (0)
Enumerate examples and the molecular basis behind these diseases. give what is ask
Viruses with negative sense RNA genomes typically, make proteins by: (Ignore retroviruses, and the unusual characteristics of coronaviruses) Translation of short RNA transcripts generated by RDRP Generating a DNA copy, which is then transcribed by host RNA polymerase. Translation of the viral genome by host ribosomes. Production of a polyprotein, which must be cleaved into smaller proteins. Generating a negative sense genome copy, which is then translated by host ribosomes.
The ribosome is the target for many important antibiotics. These drugs must discriminate between bacterial and eukaryotic ribosomes to achieve drug specificity and toxicity. For the two common antibiotics below, what is their mechanism of action and why are they more toxic to bacteria than eukaryotes? a) Tetracycline b) Erythromycin
Mild detergents, like Triton X-100, would be the best for isolation of peripheral proteins from the plasma membrane (without denaturing these proteins) because: they are non-polar with mostly negatively-charged regions they are non-polar with mostly positively-charged regions they are non-polar with mostly uncharged regions they are polar with mostly uncharged regions they are polar with mostly charged regions
Adenoviruses that cause colds do not have a lipid envelope. Such naked viruses tend to remain infectious outside the body for longer than enveloped viruses. Naked viruses are also less likely to be destroyed by soap and water. Why are naked viruses hardier than enveloped viruses?