Please pick among these 4 Protein chromatography is typically column-based: — lon-exchange — Reverse-phase/Hydrophobic interaction — Gel-filtration — Affinity
Q: What sugar units make up the structure shown? ÇH,OSO,- Но Lo- H. H. ÇOO- NHCCH, OH H H он
A: Carbohydrate consists carbon, hydrogen and oxygen. It is of different types like monosaccharides, di...
Q: Which characteristic is truc of protcins? O Proteins have up to four levels of structure. O Proteins...
A: Proteins are organic compounds which consists of amino acids, which are essential for carrying out b...
Q: The diameter of a white blood cell is 16µm. Determine the diameter of the cell in cm and inches. If ...
A: Metre is the unit of length in the International System of Units (SI system) and is represented by t...
Q: If you had designed the molecule shown below, explain in detail what biological activity, design by ...
A: A molecule is the smallest particle in a chemical element or compound that contains those element's ...
Q: An unknown sample was tested if there is a presence of lipid, after the test it shows that it is po...
A: The lipids are insoluble in water and soluble in organic solvents like chloroform, ether, and alcoho...
Q: a. What is the optimum pH of wild type β-galactosidase? _________ b. What is the optimum te...
A: An enzyme is shows its maximal activity at its optimal condition like pH, temperature, substrate.
Q: The following is the PCR reaction that is programmed in the thermocycler to amplify the cheek cell D...
A: Polymerase chain reaction (PCR) is a method that is used to amplify a selected region of DNA and pro...
Q: threose-4 phosphate (a 4 carbon aldose) is fed into glycolysis after a decarboxylation reaction that...
A: Aldose is a monosaccharide and consists of carbon chain containing a carbonyl group on the endmost c...
Q: part 1 A young athlete has trained over several months to participate in a duathlon sprint. They are...
A: Hello! Thank you for the questions. As you have posted multiple questions, I would be answering the ...
Q: Compute the total ATP that a cell can produce from 1 molecule of glucose. Case 1: NADH from glycolys...
A: The glucose molecule will undergoe complete oxidation by glycolysis, pyruvate decarboxylation, TCA c...
Q: Please answer this, I really need this. Thankyou!
A: Amylase is an enzyme that works on the hydrolysis of starch and other polysaccharides. Amylase break...
Q: please complete the table (volume, dilution factor, concentration of glucose) and determine the conc...
A: The stock solution of glucose is prepared by dissolving 500mg of glucose in 25ml of distilled water....
Q: What is the purpose of cell dissolution? 2. What is the purpose of DNA separation? 3. What is the pu...
A: Cell lysis : The method in which the cell membrane is broken down to release the inter-cellular mat...
Q: Before Lab: Compare the structures below to the structure of the substrate. Which do you think would...
A: Alkaline phosphatase (AP) is a group of enzymes which removes phosphate groups from the substrates. ...
Q: What is the intracellular voltage for Cl- if the intracellular concentration was 5 mM and the extrac...
A: The Nernst equation enables the calculation of the potential that will be established across the mem...
Q: The following sattements are true for glycogen. EXCEPT:
A: The answer of the following question is given below
Q: b. CH CH2 | H;Č CH3 - Polypeptide backbone H3C CH3 ! CH C=OH -CH2+S-S CH2– а. CH2 -CH2-CH2-CH2–CH2-N...
A: The structural organization of protein was classified into four different levels and they are primar...
Q: *H3N -Č-H CH2 он Tyrosine Draw the structures of tyrosine as different pH values. Please refer to th...
A: Ionization state of any amino acid is decided by its pKa value and pH of solution. pKa and pH both a...
Q: The following sattements are true for glycogen. EXCEPT: Branching of α(1→6) linkages every 8-1...
A: Glycogen can be defined as a multibranched polysaccharide. It functions as a storehouse of energy in...
Q: la: The 2x PCR Master mix has four main components. Two of these are PCR Buffer and MgC12. Based on ...
A: There are several questions asked. So we will answer the first 3 question. If you need the answer of...
Q: a)What Group? (Carb, Lipid, Protein, or Nucleic Acid). b)Within the group, how would you classify it...
A: Several biological substances are essential for cell biochemistry. These biological compounds are re...
Q: X Biomolecule present in organisms are essential to one or more typically biological processes excep...
A: Biomolecules plays major role in our body function. They are protein, carbohydrate, lipid, nucleic a...
Q: он CHOH он но- CHOH I ACNH II OH CH3 OH HO II но Is the sugar non-reducing?
A: Carbohydrates are composed of carbon, hydrogen, and oxygen in the ratio of 1:2:1. Carbohydrates act ...
Q: Helices can be described by the notation nm,where n is the number of residues per helical turn and m...
A: Proteins are a type of macromolecule that have a variety of roles in biological processes. It is res...
Q: The glycosidic linkage between glucose molecule in maltose is? (in 1 to 3 sentences, explain why thi...
A: Maltose is a disaccharide that is made up of two monosaccharides. units Maltose +H2O →G...
Q: What is the principle of acrolein test? Give an examples of lipids that give positive results to acr...
A: Lipids are amphipathic molecules that take part in the synthesis of the plasma membrane. Lipids are ...
Q: Which of the following is the result of the hydrolysis of 5'-CTAGTTC-3' at the b side?
A: Nucleic acids are polymers of nucleotides (which consist of phosphate group, sugar and nucleobases)....
Q: TRUE OR FALSE?
A: Metabolic pathways in living organism include series of enzyme-mediated chemical reaction that inclu...
Q: 3. What is the marker for the enzyme’s optimum condition?
A: The conditions under which an enzyme is most active are the optimum conditions(like pH,temperature)
Q: (In 10 sentences) Can disaccharide be completely assimilated and used by human cells as a direct sou...
A: Disaccharide - Sugar which is made up of 2 monosaccharides bonded via glycosidic linkage
Q: iscuss shortly the main differences among the different types of carbohydrates (monosaccharide, disa...
A: Carbohydrates: Carbohydrates are sugars that provide the body with energy and it is composed of org...
Q: True or False: Phosphates and its attachments permits phospholipid molecules to react to various m...
A: The phospholipids are composed of the hydrophilic heads and the hydrophobic tails. The hydrophilic h...
Q: Which test can be used to differentiate ribose and glucose? Benedict’s Test Iodine Test ...
A: A molecule synthesized by living organisms or cells is referred to as a "biomolecule." Carbohydrates...
Q: 1d: Should PCR primers be complementary to each other? Explain your reasoning le: As you know, exper...
A: A primer dimer is a by-product in the polymerase chain reaction (PCR), consists of two primer molecu...
Q: 4. The following compound is designed to be a prodrug (eg to undergo metabolism to generate the acti...
A: Here compound on the left side is inactive drug molecule which upon hydrolysis form compound on righ...
Q: Explain how blood glucose can be maintained through the different pathways of carbohydrate metabolis...
A: Carbohydrates are the main source of energy for plants and animals. In plants carbohydrates are form...
Q: Glucose can be isomerized to fructose to glucose isomerase. The enzyme kinetics of this enzyme was s...
A: From the Given Data, I have plotted the XY plot where, 1/S is on X-axis and 1/V on Y-axis. This is c...
Q: design a analog of dna intercalator which has electrostatic interactions with DNA and crosslinks wit...
A: DNA intercalators are hydrophobic aromatic heterocyclic compounds with flat surfaces (polycyclic, ar...
Q: How many stereoisomers are possible in Aldopentoses? Select one: a. 6 O b. 8 с. 2 d. 4
A: Stereoisomers are molecules with the same chemical formula and bound atom sequence but different thr...
Q: sterioisomers. (in 1 to 3 sentences, explain 5. A keto pentose will have why this is your answer). а...
A: Ketopentoses or aldopentoses are sugars or carbohydrates. Carbohydrates are made up of carbon, hydro...
Q: What type of molecule is shown here? Give its biological importance?
A: Carbohydrates, lipids, and proteins are the primary sources of energy for a variety of functions. Th...
Q: Most enzymes have an optimal pH valuc of O 5 1.5
A: The enzyme is a substance that acts as a catalyst in living organisms, regulating the rate of chemic...
Q: Explain your answer in 1-3 sentences only. FOLLOW INSTRUCTION! 1. Lectins are a. sugars specific to ...
A: Lectins are a type of biomolecules found in cells. Lectins are found in lentils, tomatoes, beans, pe...
Q: Ben is studying an enzyme-catalyzed reaction. In the reaction, H+ ions are formed. He found that aft...
A: pH has a drastic effect on the rate of an enzyme- catalyzed reaction. The enzyme is more active at a...
Q: What is the reaction involved in the conversion of a sugar's carbonyl to an alcohol?
A: The answer of the following question is given below
Q: Legend: Blue – wild-type β-galactosidase Red – mutant β-galactosidase _________ a. What is the...
A: The amino acid sequence of a protein determines the structure and hence the function of a protein. T...
Q: Derive a mathematical equation that calculates the speed at which DNA molecules move when placed ins...
A: Electrophoresis is a process where DNA is separated on the basis of there molecular size. the term E...
Q: Question 5: (a) Why is it important that gluconeogenesis is not the exact reversal of glycolysis? (b...
A: Glycolysis is a metabolic pathway in which glucose is converted into two molecules of pyruvate in th...
Q: Choose one example of a carbohydrates with a chiral carbon and draw its Fisher's and Haworth's struc...
A: Carbohydrates are classified as monosaccharides, oligosaccharides, and polysaccharides based on the ...
Q: I need hand written solution only
A: Hemin is a heme group present in the RBC (Red blood cells) of blood, the center of the heme an iron ...
Please pick among these 4
Protein chromatography is typically column-based:
— lon-exchange
— Reverse-phase/Hydrophobic interaction
— Gel-filtration
— Affinity
![Please propose a chromatography-based strategy to purify human insulin proteins that have
been expressed in bacterial cells.](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2Fc8bd1e73-ae88-4a23-a327-a46419b3c04f%2F45c817ae-3e06-479c-bf2b-79894204bb24%2Fpm32c5_processed.jpeg&w=3840&q=75)
![](/static/compass_v2/shared-icons/check-mark.png)
Step by step
Solved in 3 steps
![Blurred answer](/static/compass_v2/solution-images/blurred-answer.jpg)
- List the advantages of recombinant insulin.Design a pair of primers to amplify the human Insulin gene (only the blue region) Human Insulin CDNA (gene sequence, 5'-untranslated region, 3'-untranslated region) 5'agecete agccctccaggacaggctgcatcagaagaggccatcaagcagatcactgtccttctgccATGGCCCTGTGGA TGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGACCCAGCCGCAGCCTTTGTGAACCAAC АССТСTGCGGCTCАCАCСТGGTGGAAGCTCTCТАССТАGTGTGCGGGGAACGAGGCTTCTTCTACАCACСCА AGACCCGCCGGGAGGCAGAGGACCTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCC TGCAGCCCTTGGCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGCT CCCTCTACCAGCTGGAGAACTACTGCAACTAGacgcagcccgcaggcagccccccacccgccgcctcctgca ccgagagagatggaataaagcccttgaaccaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaŋ' Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN* 5'-C 5'-I ]-3' ]-3' Primer: I Primer: 2 I know the answers are 5'-ATGGCC-3' for primer 1 and 5'-CTAGTT-3' for primer 2 but I'm not sure why. Could some explain why?why is LDHA an attractive target for a cancer therapeutic? https://www.nature.com/articles/s41598-019-40617-3#Tab1
- Induced pluripotent stem cells have allowed scientists to model various diseases and screen drugs in these in vitro models. Please provide information on induced pluripotent stem cells and their use as described above (model various diseases and screen drugs in these in vitro models). Please explain clearly and nicely. THANKSWhich ONE of these statements is the most accurate definition of the mode of action of imatinib? Select one: A.It is a specific inhibitor of the BCR‐ABL1 fusion protein and blocks phosphatase activity by competing with adenosine triphosphate (ATP) binding B.It is a specific inhibitor of the BCR‐ABL1 fusion protein and blocks tyrosine kinase activity by competing with adenosine triphosphate (ATP) binding C.It is a specific inhibitor of the BCR‐ABL1 fusion protein and blocks tyrosine kinase activity by interaction with the enzyme site D.It is a specific inhibitor of the BCR‐ABL1 fusion protein and blocks phosphatase activity by interaction with the enzyme siteWhich of the following best describes the production of insulin in by bacterial cells. The biosynthetic pathway that produces human insulin is introduced into bacterial cells on a plasmid. Insulin is purified from bacterial lysates by electrophoresis. Human insulin in a peptide hormone comprised of two chains A and B. Only B chain is required, It is produced by injecting bacteria with MRNA encoding B chain peptide, and purifying the peptides with an antibody. Fuman insulin in a peptide hormone comprised of two chains A and B. It is produced by injecting bacteria with transgenic plasmids containing MRNA encoding either the A and B chain peptides, and purifying the peptides with a mix of antibodies against tne A or B chain. aman nsulina peptide hormone comprised of two chains A and B. They are produced separately as fusion proteins with beta-galactosidase when bacterial cells are transformed with plasmids containing either A or B chain with the lacZ sequence. Once purified they are…
- Plasma PDGF levels can be a diagnostic marker for severity and progression of breast cancer. The assay data below shows the plasma levels of PDGF in normal individuals, Stage II and Stage IV (More severe). You are treating a patient with breast cancer and assay indicates that their plasma PDGF level 6 fmoles/ 100 uL.Based on this info, in which stages has this patient's cancer progressed? Explain what process this patient's tumor has likely undergone and which cell types you would expect to now be associated with this tumor.Consider the gal10D56 reporter gene. In 300 words or fewer, describe 1) the role of GAL7 in galactose metabolism and its importance for cell function 2) the mutation present in the gal10D56 reporter gene 3) the consequence of this mutation for GAL7 expression in wild type cells, 4) the mechanism by which certain mutations can suppress the effects of gal10D56, and 5) the specific purpose for using this reporter gene.Why is recombinant Insulin produced by genetic engineering need to be processed?
- Microtubule stabilisers may be used as anticanceragents. Propose a set of four molecules from the literature that can be overlaid to give a commonpharmacophore. Label the key structural featuresthat indicate some similarity between themolecules.You are the lead scientist for a pharmaceutical company responsible for evaluating over 30,000 known compounds as potential drugs that inhibit a specific human enzyme that is often over-expressed in cancer cells. Your team has purified this phosphodiesterase and done initial assays to test for inhibition by all 30,000 compounds. You have asked your team to more fully test the two compounds that showed the strongest inhibition of the phosphodiesterase (both showed 50% inhibition of the phosphodiesterase at inhibitor concentrations of 1 g/ml. Below are the results for their enzyme assays of velocity (Velocity units are umoles of product formed per minute) of the reaction as a function of the substrate concentration. The Vice-President for Research in your company wants to know which compound to bring to clinical trial (Phase I trials run to several million dollars, so you get to choose only one). She needs the answer and a justification of your choice by Friday.[S] uM V unihib V…Nicotinamide Adenine Dinucleotide (NAD) Assay (SIGMA Kit MAK037) analysis of tissue samples initially requires: centrifugation at 13,000g for 10min to homogenise tissue. centrifugation of 20mg of tissue at 2,000rpm with Extraction Buffer. freezing and thawing for 2 cycles of 20min before addition of Extraction Buffer. homogenization of PBS washed tissue with Extraction Buffer.
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781319114671/9781319114671_smallCoverImage.jpg)
![Lehninger Principles of Biochemistry](https://www.bartleby.com/isbn_cover_images/9781464126116/9781464126116_smallCoverImage.gif)
![Fundamentals of Biochemistry: Life at the Molecul…](https://www.bartleby.com/isbn_cover_images/9781118918401/9781118918401_smallCoverImage.gif)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781305961135/9781305961135_smallCoverImage.gif)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781305577206/9781305577206_smallCoverImage.gif)
![Fundamentals of General, Organic, and Biological …](https://www.bartleby.com/isbn_cover_images/9780134015187/9780134015187_smallCoverImage.gif)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781319114671/9781319114671_smallCoverImage.jpg)
![Lehninger Principles of Biochemistry](https://www.bartleby.com/isbn_cover_images/9781464126116/9781464126116_smallCoverImage.gif)
![Fundamentals of Biochemistry: Life at the Molecul…](https://www.bartleby.com/isbn_cover_images/9781118918401/9781118918401_smallCoverImage.gif)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781305961135/9781305961135_smallCoverImage.gif)
![Biochemistry](https://www.bartleby.com/isbn_cover_images/9781305577206/9781305577206_smallCoverImage.gif)
![Fundamentals of General, Organic, and Biological …](https://www.bartleby.com/isbn_cover_images/9780134015187/9780134015187_smallCoverImage.gif)