Please draw the structure of the 19 L-a-amino acids and proline in any form, as you prefer. You may want to use a letter-size sheet or larger, it's up to you. Guidi
Q: Draw the amino acids serine and threomine bonded together with a petide bond.
A: Amino acid
Q: 12. Receptor immobalization on surfaces for developing bio-sensors
A: Immobilizing receptors on surfaces is essential to developing biosensors, which detect and quantify…
Q: 1. We tested a hypothetical Unknown #3. Does our result below mean the compound is present or absent…
A: In order to find whether or not a particular biomolecule is present in an unknown sample, we…
Q: The value of AGO for the conversion of 3-phosphoglycerate to 2-phosphoglycerate (2PG) is +4.40…
A:
Q: Each of the reactions is catalyzed by an enzyme. For each reaction, classify the enzyme according to…
A: Most of the enzymes are divided into six major classes. They are1. Oxidoreductases2. Transferases3.…
Q: A peptide has the sequence: Glu–His–Trp–Ser–Gly–Leu–Arg–Pro–Gly 1. What would be the net charge of…
A: The ionizable groups in a peptide include its N-terminal alpha-amino group, C-terminal…
Q: Consider the O2 binding curve shown below for hemoglobin under normal physiological conditions. In…
A: Oxygen dissociation curve is the graphical representation of effect of partial pressure of oxygen on…
Q: 3) After watching the video convert the monosaccharides from a Fischer to a Haworth Projection. a)…
A: Fischer and Haworth ProjectionsFischer and Haworth projections are two ways of representing the…
Q: In the absence of 2,3-bisphosphoglycerate, the binding of oxygen by hemoglobin: a. is…
A: In the absence of 2,3-bisphosphoglycerate (2,3-BPG), the binding of oxygen by hemoglobin undergoes a…
Q: Illustrate the ATP hydrolysis reaction, its regeneration and the AG for both reactions. Show where…
A: ATP is the energy currency of the cell. It is simply an adenosine molecule bonded to a triphosphate.…
Q: 1. Enzymes have known attributes and functions. Which of the following is NOT its common attribute…
A: Enzymes are biological catalysts. They speed up the rate of chemical reactions. They do this by…
Q: Which of the following define the stereochemistry of alanine (as per the structure shown)? Note:…
A: stereochemistry can be defined as the arrangement of functional groups on the alpha carbon atom with…
Q: List down 5 chemical properties of water that makes it an indispensable compound for life. Select…
A: Water is the solvent of terran life. The body of all lifeforms on earth is predominantly water,…
Q: A receptor-ligand complex has a dissociation constant of Kd = 20 nM. The rate of receptor-ligand…
A: The reverse rate constant (k-1) is a parameter used in chemical kinetics to describe the rate at…
Q: Draw a diagram to illustrate the locations of the omega (w), phi (p), and psi (4) rotational bond…
A: Omega (ω), phi (ϕ), and psi (ψ) angles are used to illustrate how atoms rotate along the polypeptide…
Q: Choose any/all that apply to the proton-motive force and ATP synthesis. The active pumping of…
A: The active pumping of protons through ATP synthase against their concentration gradient provides the…
Q: Which of the following best describes how the large and branched side chains are organized within a…
A: Beta-sheets are one of the most common regular secondary structures seen in proteins. The…
Q: With the consideration of thermodynamics, why would a bacterium that can oxidize ammonia to nitrate…
A: In complex microbial competition, thermodynamics determines organism success. Some of these bacteria…
Q: 7. How many liters of a mouthwash can be prepared from 100 mL of cinnamon flavor if its…
A: To prepare a mouthwash with a concentration of 0.5% (v/v) cinnamon flavor, you need to calculate how…
Q: Given the following reactions or reaction conditions, determine which are spontaneous. Choose one or…
A: In thermodynamics, the spontaneity of a reaction is determined by the Gibbs free energy change (ΔG).…
Q: | a) Match the type of bond with the role below: Bond_type (a) phosphodiester (b) N-glycosidic (c)…
A: Nucleic acids are one of the 4 biomacromolecules. Nucleic acids are generally found in 2 forms in…
Q: name from the following terpene, steroid, Prostaglandin, arachidonic acid, triglyceride, saturated…
A: Lipids are a diverse group of organic compounds that are essential to the structure and function of…
Q: Which residue of phenylalanine hydroxylase is phosphorylated? A. Met18 B. Ser16 C. Ser12 D. Tyr24
A: C. Ser12Serine 12 is the residue of phenylalanine hydroxylase that is phosphorylated, and this…
Q: Macm Determine the charge of the peptide at pH 5.5. -2 O -1 0 +1 +2 Determine the charge of the…
A: H |H-N-C-COOH | | H HIn this structure, both the amino group of Glycine…
Q: Fractional saturation, Y, is represented by Y = PO₂" 2 n n pO₂+ P50' The term po₂ is the partial…
A: By the equation, Y=pO2n/P50n+pO2nvalues:P50=26 torr…
Q: Which of the reactions are spontaneous (favorable)? L-malate + NAD+ oxaloacetate + NADH + H+ AG =…
A: Gibbs free energy change (ΔG) is a thermodynamic quantity that represents the maximum reversible…
Q: The phosphoryl group transfer potentials for glucose-1-phosphate and glucose-6-phosphate are -20.9…
A: Details
Q: Enzymes are important molecules in biochemistry that catalyze reactions. The energy diagram…
A: There are four types of biological macromolecule: proteins, nucleic acids, lipids and…
Q: Energy Conversion Problem 1. a) Influence of concentration on the free energy change. In frog…
A: For the chemical reaction:aA + bB -> cC + dDThe reaction quotient Q is calculated as:Q = ([C]^c *…
Q: Draw the structural formula for adenine and thymine bonded together with hydrogen bonds as they…
A: DNA is deoxy ribo nucleic acid which is a genetic material present inside the nucleus of every…
Q: draw in the structure of each metabolic intermediate in the glycolysis pathway in the figure above.…
A: Glycolysis is the metabolic pathway by which 1 glucose molecule is converted to 2 pyruvate…
Q: Which of the following molecules' production is likely to be subject to feedback inhibition in a…
A: Tryptophan synthesis is typically regulated by feedback inhibition in bacteria. This process is…
Q: Compare the stability of the two salt bridges shown circled in blue at pH 8.4. The carboxylate ions…
A: To determine the stability of the two salt bridges at pH 8.4, we need to consider the protonation…
Q: 1. In a catabolic pathway, metabolite X gets converted into metabolite Y, metabolite X metabolite…
A: is the standard change in Gibbs free energy i.e. the change in Gibbs free energy under standard…
Q: Which of the following molecules is richest in energy when metabolized? Glucose Linolenate, a fatty…
A: Glucose is the primary source of energy for the body. When there is no glucose available, the body…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: Glycine Alanine Valine Leucine Isoleucine Name Structure 1-Let Abbr 3-Let Abbr Class (non-polar,…
A: Amino acids are organic compounds that form the building blocks of proteins in cells. The structure…
Q: 1. In human beings, what is the major control of de novo pyrimidine nucleotide synthesis? A.…
A: Enzymes can be classified as biological catalysts. They enhance the rate of chemical reactions. This…
Q: The OH group of the serine side chain (R-OH) can undergo dissociation to form R-O- and H+. However,…
A: The proteins are constituted of amino acids linked via peptide linkages.The side chains of amino…
Q: In patients with Lesch Nyhan Syndrome, purine nucleotides are overproduced and over excreted. The…
A: The body creates purines through de novo synthesis. Hypoxanthine-guanine phosphoribosyltransferase…
Q: What is the IUPAC name for the following molecule? Sc
A: IUPAC nomenclature rules for alkanes:• Identify the longest continuous carbon chain.• Identify the…
Q: 1.How to prepared SC Yeast Media Buffered with HEPES pH 6.75?
A: In yeast cell culture research, SC (Synthetic Complete) Yeast Media buffered with HEPES at pH 6.75…
Q: 4. Suppose that you conducted a count using hemacytometer counting chambers slide, you counted (387)…
A: A hemocytometer, also known as a counting chamber, is a specialised laboratory equipment used to…
Q: 256.Can the X subunit bind to ssDNA alone? How do the authors illustrate this and why is this…
A: DNA polymerase III holoenzyme is a complex protein that replicates bacterial DNA. A large enzyme…
Q: An Fab fragment binds to lysozyme with a dissociation constant of Kd = 10-¹¹ M. A 1 nM (10—² M)…
A: To determine the concentration of added Fab at which half of the lysozyme will be bound to the Fab…
Q: Some reaction components are shown on the left. Match them to the reactions catalyzed by glutamine…
A: Glutamine is a polar, uncharged amino acid. Glutamate is a negatively charged, acidic amino…
Q: The figure to the right shows the setting displays of three pipettes, as labeled. What volume in…
A: Micropipettes are indispensable tools in molecular biology and biochemistry. We cant imagine science…
Q: Which nucleotide forms are used in the cellular reactions for DNA replication? a. 3' triphophates b.…
A: DNA replication is the process by which a new DNA molecule is synthesized using an already existing…
Q: Order the following cells in terms of the size of their receptive field, from smallest to largest:…
A: The size of receptive fields generally increases as you move from early sensory processing areas to…
Q: 10 mL of 1.8 M acetic acid (CH3COOH) is titrated with 1.0 M sodium hydroxide (NaOH). The titration…
A:
Trending now
This is a popular solution!
Step by step
Solved in 3 steps with 1 images
- 01 Description Please draw the structure of the 19 L-a-amino acids and proline in any form, as you prefer. You may want to use a letter-size sheet or larger, it's up to you. Guiding principle: You want to understand the differences among amino acids. Although you may want to only draw the R-group it's preferable to draw it along with the rest of the molecule (i.e., the Ca, the amino group and the carboxyl group). Here are some examples (your drawings should not limited to the following styles): NH₂ OH Alanine H H O OH Proline lysine alarmy stock płwłos Tryptophan OH COOH | H₂N-C-H CH₂ Phenylalanine arginineE. PROTEIN PRIMARY STRUCTURE ELUCIDATION. 1. Determine the primary structure of the protein described below. Write the final sequence using the corresponding three-letter code for each amino acid. Example: M-F-Y-R should be written as Met-Phe-Tyr-Arg Treatment with cyanogen bromide and sequencing yields the following peptide fragments: o D-M o R-A-Y-G-N o L-F-M Chymotrypsin digestion and sequencing yields the following peptide fragments: o G-N D-M-L-F o M-R-A-Y o oDetermining the amino acid sequence in a protein usually in- volves treating the protein with various reagents that break up the protein into smaller fragments that can be individually sequenced. Treating a particular 11-amino acid polypeptide with one reagent produced the fragments: Ala-Leu-Phe-Gly-Asn-Lys Trp-Glu-Cys Gly-Arg Treating the same polypeptide with a different reagent pro- duced the fragments: Glu-Cys Gly-Asn-Lys-Trp Gly-Arg-Ala-Leu-Phe What is the amino acid sequence of the polypeptide?
- Protein-4YU4 is given, choose a part of it (containing at least 30 amino acid residues), find the amino acid sequence (sequence in it), identify what functional groups the amino acid substitutes contain (carboxyl group and 2-position the Nitro group will form amide bonds, forming the covalent basic structure of the protein). What different interactions can occur between these functional groups? How will it relate to the spatial structure of the protein?A. Write the structure of the following peptide at pH 5.0 and calculate its net charge at this pH. Asp-His-Tyr-Arg-Lys-Leu-Thr-Gln. Based on the pKa value of the ionizable groups. B. A polypeptide consisting only of L-glutamate residues (poly-L-glutamate) may have a random coil or helical structure depending on pH. Explain this behavior by indicating at what pH values the helical structure will be favored.the resonance stabilization of the amide linkage has profound effects on protein structure. Which of the following are the direct effect(s) of this on protein structure? Select all that apply All six atoms around the bond (including the Co) lie on the same plane There is no free rotation about the peptide bond. The bond between the carbon and the nitrogen in the peptide bond keeps "flickering" between being a single bond and a double bond. The peptide bond is polar. The nitrogen in the peptide bond cannot accept a hydrogen bond.
- Asp-Gly-Lys-Glu-Ile-Phe Draw its full chemical structure as it would exist at pH = 7.0. Draw an arrow pointing to each peptide bond. Identify the net charge of the peptide and briefly explain how you arrived at this answer.I need help with drawing Hydrogen bonding between two tripeptide: Ser-Lys - Ser. In my class, we are required to give dash or wedge for the side chain R in the amino acid, and draw zig zag for the chain. In two separate drawings, can you draw one where it is the hydrogen bonding between the peptides backbone that connect the two tripeptides and the other is the hydrogen bonding between the side chains. ThanksChymotrypsin digestion, separation of peptides, and Edmann technique give the sequences for peptide fragments as follows: C-1 G-A-E-A-T-E C-2 G-K-V-G-A-H-A-G-E-Y C-3 V-L-S-P-A-K-T-N-V-K-A-A-W What is the sequence for the peptide? NOTE: Label the fragments when reconstructing the peptide chain e.g. for trypsin T-1, T-2 etc...
- Identify and briefly describe three different PEGylation strategies you can use to PEGylate this peptide and draw the chemical structure of the resulting mPEG peptide conjugatesGABA (B) protein Need help answering questions about the GABA(B) protein. What is the primary structure Describe secondary structure (alpha-helix, beta sheet, and how many of each and what percent of the total protein)What is the tertiary structure (which should also show secondary structure)Does the protein have a quaternary structure, if so what is it?GTTTTCACTGGCGAGCGTCATCTTCCTACT 10. Generate a secondary structure prediction for one identified protein.