Of the four sequences below, one can be that of a peptide, others can't.Which is the one that can correspond to a peptide =?1. ABCDEFG2. HIJKLMNO3. QRSTUVW4. CDEFGHIO 3O 2O 1O 4 In a solution with pH 1.0 most molecules of amino acid H have an overallcharge of-1+1+2O-1O +2O +1

Answered: Image /qna-images/answer/1f82362f-2233-4dcd-956b-170830c127e9.jpg

Answered: Of the four sequences below, one can be…

Of the four sequences below, one can be that of a peptide, others can't. Which is the one that can correspond to a peptide =?

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Related questions

Q: help please answer in text form with proper workings and explanation for each and every part and…

A: Step 1: Generally peptide bond is a bond occurs between two amino acids. Each amino acid has two…

Q: Suggest a scheme you will follow to synthesis the dipeptide Ala-Gly Explanation of scheme should be…

A: In the synthesis of peptides, amino acids are having two functional groups so the shelf condensed…

Q: The given dipeptide is Asp‑Tyr. Indicate the charge state for each structure at the given pH by…

A: The pH 1 is highly acidic. Hence the peptide will exist as an ammonium carboxylic acid. The terminal…

Q: Imagine the main chain of a protein bends back on itself, so that two amino acid residues R, and R,…

A: This question is based on structure of amino acids and interactions in a protein structure.

Q: What is different about the primary structures of RNA and DNA? Match the words in the left column to…

A: DNA and RNA are types of nucleic acid .DNA stands for deoxyribonucleic acid and RNA stands for…

Q: In which model is it easiest to follow thepolypeptide backbone?

A: Polypeptide backbone is that when covalent linkage occurs from one amino acid to the other which has…

Q: help please answer in text form with proper workings and explanation for each and every part and…

A: Step 1: Identify the Amino Acids in the Peptide Structure1. Examine the structure: Look at the…

Q: Draw the predominant ion for Gly-Asp-Glu at its pl.

A: Please have a look on the solution:

Q: Part 2. Macromolecules 1. Before attending Lab 3, use your text book to complete Table UI-2 by…

A: #A: The monomer of a protein is an amino acid. Your structure for the protein monomer, amino acid…

Q: The use of salt bridges or hydrophobic interactions (or pockets) to stabilize interactions between…

A: The quaternary structure of a protein is the association of several protein chains or sub-units into…

Q: Draw the tetrapeptide below out in full chemical structure by attaching the four amino acidsin order…

A: The given amino acids are: Tyr – Tyrosine Cys – Cystine Met – Methionine His – Histidine

Q: Protease enzymes are a type of protein made up of: Select one: Peptide Carbohydrates Pepsin Amino…

A: Proteins that function as biological catalysts are known as enzymes. Catalysts help to speed up…

Q: Which two amino acids are most similar? O Val, Asn Tyr, Gly O Gin, Asp His, Pro Ser, Thr

A: This question belong to biomolecules that's protin.

Q: 5. Arg and Lys Asp and Lys Pro and Glu Among these amino acid combinations listed above, only…

A: Answer: Only the combination of Asp and Lys have side chains with groups that have the greatest…

Q: a 3d structure of protein with acces number of P02008 at uniprot database.

A: The objective of the question is to find the 3D structure of a protein with the access number P02008…

Q: This image represents the structure of a protein segment with amino acid side chains pointing off…

A: Step 1 Amino acids are the building bits of large biomolecules named as proteins. In the structure…

Q: Question 10 Draw the structure of the peptide with the following sequence CHEMIST O O a) Indicate…

A: The question is based on the concept of amino acids and peptides. we need to draw the peptide…

Q: Question) Draw the by the Chemdraw following and write the Molar Mass? 1-Amino-3-bromonaphthalene…

A: You have asked multiple type questions, we will solve only first questions for you. If you want any…

Q: X: reproduce the interatomic interactions Y: define a computable energy (such as Gibb's free energy)…

A: The complete structure of a protein can be divided into 4 based on the complexity: primary,…

Q: The image below is a positive ionization mode Electrospray ionization-mass spectrum (ESI-MS)…

A: A multiple choice problem based on mass spectrum, which is to be accomplished.

Q: D. Label (*) next to each chiral carbon in the molecules below. And indicate which carbon atom is…

A: Hello. Since your question has multiple sub-parts, we will solve the first three sub-parts for you.…

Q: help please answer in text form with proper workings and explanation for each and every part and…

A: To determine which variant of hemoglobin (Hb) has the higher isoelectric point (pI) between…

Q: 1. Draw the structure and interaction that occurs between the following R groups of amino acids in…

A: a)The interaction that can occur between the R groups of asparagine and serine is a hydrogen bond.…

Q: Amino acid structure and composition: Assuming physiological pH conditions, draw the peptide…

A: Answer: 1. The peptide chain is positively charged at physiological pH due to the side chain of…

Q: ogen pept is rigid, take place about the N-Co and the Co-C bonds in a protein (Co is the a carbon…

Q: H н H.C Н CH₂ I н CH₂ i Н Н H. C на H Ï CH₂ H H Н | Н H

A: Amino Acid Amino acid are white crystalline solid . It contain both basic amino group(-NH2) and…

Q: You are studying a peptide in the sky bison that has the sequence below.…

Q: Assuming you have four different bases, how many amino acids can you code for with two-base…

A: Class of organic compounds that contain both amine and carboxylic acid group in the single carbon…

Q: 4. Draw the peptide AVG showing each amino acids and the peptide bond?

A: The given peptide name is AVG.We have to draw the peptide structure.Also, we have to properly show…

Q: Please correct answer and don't use hend raiting

Q: Part 2. Macromolecules 1. Before attending Lab 3, use your text book to complete Table UI-2 by…

A: “Since you have posted a question with multiple sub-parts, we will solve first three sub-parts for…

Q: WDANIKQRLSTEYKQ (a) How many full turns are in this a-helix? (b) What is the length of the helix (in…

A: An α-helix, also known as a-helix, is the secondary structure of protein. In an α-helix, the N-H…

Question

Of the four sequences below, one can be that of a peptide, others can't.
Which is the one that can correspond to a peptide =?
1. ABCDEFG
2. HIJKLMNO
3. QRSTUVW
4. CDEFGHI
O 3
O 2
O 1
O 4

In a solution with pH 1.0 most molecules of amino acid H have an overall
charge of
-1
+1
+2
O-1
O +2
O +1

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step 3

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 3 steps with 2 images

SEE SOLUTION Check out a sample Q&A here

Similar questions

A. Circle the peptide bond in this structure. 0 || H3N CH- - C N-CH-C-0 iabiple CH3 -
Draw the protein given by the sequence TIP and circle any chiral carbons. 6
MN.49.
Please don't provide handwriting solution
Considering the peptide structure on the image, label N-terminus and C-terminus, circle each of the peptide (amide) bonds, and provide the primary sequence of the protein using three letter abreviaciones for the amino acids
Am I correct? Please help
I'm struggling with this chemistry. Can you help me?
Give detailed Solution with explanation (don't give Handwritten answer,,)
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
The chemical structure of cysteine (C3H-NO₂S) is shown below. Highlight each atom that is in an amino group. :S H | HC-H H-C | H-N-H :0: || C. -0-H X 5 Save For Late
Identify the features of the two bonded amino acids depicted in the image. HOHH | || | | N-C-C-N-C-C CH CH₂2 CH₂2 CH₂ CH₂ I I CH₂ CH₂ NH₂+ O OH Answer Bank hydrophilic side chain hydrophobic side chain peptide bond carboxyl group amino group
The tertiary structure of a protein is stabilized by several types of interactions between side chains. Classify the highlighted interaction (or bond) in each example. Answer Bank Hydrogen bond OH -CH,-C=O…HO-CH, Electrostatic interaction (ionic bond) 요 -CH,-NH, O-C-CH, OC-CH Hydrophobic interaction CH3 H3C -CH CH- CH, HẠC Disulfide bond -CH₂-S-S-CH₂-