Answer Q23, 24, 25 LAJIRepresented by the value 787 kJanotQuestion: 23-27 concern the energy cycle forsodaunt chlorilc belowNa g Chte12 l motNa re 1/2C1496 kJ mol t349 kJ nulNa (Ta Na C14061J im 377 k molSelect from A to D'the graph which correctlyrepresents the situation in each of the following:28.Na s12Ch107J mol787 J molThe fraction of molecules of a gas havingNA 1201er411 molNaCLa specific speed (y-axis) at a particulartemperature[A] [B] [C] [D]29.The vapour pressure of a mixture ofphenol and aniline (y-axis) againnst .cnmpositionof the misture.Some energy changes m the evele above areStandard enthalpy of solution for sodiumJA).chlorideJA||B][C] [D]The rate of zero order reaction (y-axis)30.[B]First electron affinity for chlorineagainst the concentration of the reactant1attice energy for sodium chloridelydraton encrgy for Na (g and Cl (g)(D|Select from AA to D the energy change31.The boiling pent of a mixture o:cyclohexane and ethanol (y-aNis) againstcomposition of the mixture23Represented by the value -349 k molQUESTIONSDIRECTIONS: for each of the questionsbelow ONFcorrect. Decide which of the responses is (are)correct, the choose24.JALUBLICIIDIWhose vaiue is -783 KFmol32-4625.or MORE of the responses is (are)Using the energv eycle above the value of26.the standard cnthalps ot formation of sodiumchloride in klmolisJAJ-411 (B| 787 (C) Fi 163 (DJ -787Using the energy cycle above the value ofthe standard enthalpy of solution of sodiumchloride in kJ mot' is[A] +381 [B] -410 [C] +4 (D] +410QUESTION: 28-31 concern the followingIf 1.2.3 are all cerrectI1I and 2 only are correctI2 and 3 only are correctIF3 only is corect27.SUMMARY AND DIRECTIONSDABC1,2.3 all1,2 only2,3types of graphsonlyonlycorrectcorreetcorrectWhich of the foliowing statementconceming phenylamine (aniline) is (are) true?It yield nitrogen gas when treated with32.It is a weaker base than mcthylamineIt react with ethanovl chloride to give an2.3.amine30

Answer 23 :- B option is correct. First electron affinity of chlorine. Electron affinity is…

Answered: Answer Q23, 24, 25

Science

Chemistry

Answer Q23, 24, 25

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Similar questions

Which protein folding interaction(s) is/are most likely to occur on the outside of a protein pocket in water (choose all that apply). a. hydrogen bonding b. hydrophobic effects c. salt bridge
28. What is the major force responsible for the formation of an a-helix in protein secondary structure?
2:11 A O l 85% casein micelles are stabilized internally by: Hydrophobic interactions, calcium phosphate bridges, and K-casein. Hydrophobic interactions and calcium phosphate bridges. Hydrophobic interactions and K-casein. Calcium phosphate bridges, and K-casein. At cold temperature, Somatic cells and bacteria are not able to produce lipase and protease that affect the quality of cheese. False True Apart from quantitative levels, fat fractions and their ratios play a significant role in gel formation and strength of yogurt. * True False II
Why are there two MHCL variables?Surely that's a typo and the second is meant to be MMgOH(2) ?
What is the value of KspKsp for Tl2SO4?
Calculate the isoelectric point for the dipeptide Asp-Arg. Use the pKa table available on Latte. isoelectric point =
Shown below is a section of beta-sheet from the protein thioredoxin. Amide nitrogens are indicated by circled Ns, carbonyl oxygens by Os, and hydrogen bonds by gray lines. M strand 1 MO strand 3 (N) O 1 2 3 4 For each strand of the sheet (1, 2, 3, 4) indicate the direction (top or bottom) of the N-terminus. [Select] strand 2 [Select] O [Select] strand 4 [Select] strands 1 and 2 Determine the orientation (parallel or antiparallel) of each adjacent strand to one another. [ Select] AHO strands 2 and 3 [Select] N strands 3 and 4 [Select] >
Some Protein P binds to 1 molecule of X. The fractional binding curve (θ vs. [Ligand]) shows that θ = ⅓ when [X] = 6 mM. What is the Kd for X binding to P?
Please Indicate the coordination number for the iron surfur protein in the picture. A) 5 B) 6 C) 3 D) 4 E) 2
a. Но Но-с. CH2-CH-NH-CH3 HCI ČH3 b. 3. Draw the tripeptide Alanine-Cysteine-Serine (R1 = CH3, R2 conditions and list the net charge on the protein (5 pts. e. %3D a. pH = 1
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
name the structure and indicate sterochemistry