Q: After 3 rounds of replication, what percent of the DNA molecules will contain only 15N? You take a…
A: deoxyribonucleic acid, or DNA, is a biological macromolecule that carries hereditary information.…
Q: Which enzyme is incorrectly paired with its function? A. DNA polymerase III-proofread DNA base pairs…
A: Option D is the answer. Activity of primase is incorrect among the given options. Activity of DNA…
Q: Which of the following enzyme is required for end to end joining of DNA?a) DNA ligaseb) Restriction…
A: DNA (deoxyribonucleic acid) is a biological macromolecule. It consists of repeating units of…
Q: DNA polymerases make errors in matching as DNA is synthesized. These errors can be detected and…
A: DNA replication is the process by which two exact copies of DNA are made from an original DNA…
Q: Which of the following could be used to repair a single nucleotide error in replication or a damaged…
A: Gene mutations are rare and random changes in DNA sequence which result in alteration of polypeptide…
Q: Which of the following DNA repair mechanisms relies on homologous DNA recombination for the repair…
A: Homologous recombination repair is a DNA repair process that includes the invasion of an undamaged…
Q: Fill in the blank spaces below with the most appropriate terms. The word bank is not provided. DNA…
A: During cell division DNA makes a copy of itself and this process is called DNA replication. In this…
Q: ) Base excision repair requires polymerases. B.) In DNA repair by excision, the non-damaged strand…
A: Solution : Correct option is d
Q: Which of the following DNA repair systems could be used to repair the damage caused by UV light…
A: Due to the exposure to the UV rays, the structure of DNA gets distorted causing bends which leads to…
Q: The original DNA template starts with T following the primer sequence if the smallest fragment…
A: Dideoxy nucleotides are similar to regular, or deoxy, nucleotides, but they lack a 3’ OH group.…
Q: The flask where you grow the E. coli culture got exposed to UV rays, explain what kind of DNA damage…
A: In order to maintain the integrity of information contained in DNA, it has various repair…
Q: You have 15 tubes, each containing 5 ul of DNA (each tube has a different DNA to cut). You want to…
A: A reaction mixture is a combination of 2 or more reactants in definite proportions to carry out a…
Q: Which of the following enzymes is the principal replication enzyme in E. coli?a) DNA polymerase Ib)…
A: E. coli bacteria contains 5 different DNA polymerases: DNA Pol I DNA Pol II DNA Pol III DNA Pol IV,…
Q: In a specific step for PCR, the single-stranded DNA attaches x to primer sequences complementary to…
A: The steps of PCR are - Step 1: Denaturation The DNA double helix separates due to rise in…
Q: Examine the DNA model, what are the features that contribute to the stability and the ability of the…
A: DNA differs from RNA in having deoxyribose sugar while RNA contains ribose sugar. In RNA, uracil…
Q: Choose the right combination of components required to set up a polymerase chain reaction from the…
A: Polymerase chain reaction is a method widely used to rapidly make millions to billions of copies of…
Q: DNA polymerase is important in the replication process because it can join together segments of DNA…
A: DNA is basically genetic material in all the organism . In Prokaryotes , it is safely stored inside…
Q: DNA polymerase replicates DNA producing a _______ strand.
A: Answer: DNA polymerase replicates DNA producing a new complementary strand. Explanation: Duplication…
Q: By seeing the picture, how are Recombinant DNA formed? What is the difference between genetic…
A: Introduction: Genetic engineering or genetic modification or genetic manipulation involves direct…
Q: During replication, proofreading is accomplished by _____ and removes the incorrect base __
A: Answer: DNA REPLICATION : It is the process in central dogma where DNA replicates itself resulting…
Q: Which of the following will lead to DNA cutting more frequently? Choose all that apply.
A: The restriction enzymes are enzymes that cut the DNA at specific nucleotide sequences called the…
Q: If DNA polymerase makes an error during copying it creates a ________ in the DNA.
A: Question - If DNA polymerase makes an error during copying it creates a ________ in the DNA.
Q: Which of the following is required to make complementary DNA (CDNA) from RNA? reverse transcriptase…
A: The central dogma in cell biology is DNA -> RNA -> Protein. The first process is the…
Q: The following diagram shows the two strands of a single DNA molecule, with a pair of PCR primers…
A: PCR or polymerase chain reaction is a rapid and versatile in vitro technique for amplification of…
Q: how enzymes are involved with proofreading newly formed DNA molecules. 1. DNA polymerase does not…
A: In proofreading process, The polymerase checks whether the recently added base has matched…
Q: Which enzyme is responsible for proofreading nucleotides during DNA replication? a nuclease b…
A: Transmission of DNA or genetic material is very crucial to propagate gene from parent to offspring.…
Q: Okazaki fragments are short DNA pieces that explain how the DNA polymerase can continue the…
A: Replication is the process of synthesis of new strands of DNA from the parental DNA molecule and it…
Q: A person with deficient or abnormal ligase may have an increased cancer risk and chromosome breaks…
A: Enzymes are essential biocatalysts for all living cells. Enzymes carry out various functions in the…
Q: DNA polymerase III adds a nucleotide to the 3' end of the strand. leading strand. All of the answers…
A: Concept used: DNA Replication DNA Replication : The process where the strands of DNA are…
Q: During the process of Gel Electrophoresis, DNA will move through the gel towards the-------end of…
A: DNA is the genetic material. It is responsible for regulating cell activities.
Q: Which of the following ingredients precisely controls which small section of a very large DNA…
A: The acronym PCR stands for polymerase chain reaction. It's a test that looks for genetic material…
Q: Which of the following is directly responsible for catalyzing the synthesis of a complimentary…
A: *The answer of this question is option 3 that is Taq polymerase. *Taq polymerase isolated from…
Q: DNA Polymerase Another enzyme, and arguably the most important, is DNA polymerase. This enzyme's…
A: DNA Polymerase and DNA Primase are the Enzymes responsible for the DNA replication process.
Q: Which of the following enzymes is not involved in bacterial DNA replication? DNA Polymerase III…
A: Bacteria is a prokaryotic organism that do not DNA organised as chromosomes. It lacks well defined…
Q: Why is it more important for DNA to be replicated accurately than transcribed accurately?
A: In molecular biology, DNA stands for Deoxyribonucleic acid which is a type of nucleic acid. It is…
Q: Promotors are part of the DNA but enhancers are proteins that stick to the DNA True or false
A: Gene expression is regulated by differential rate of transcription and translation of different…
Q: State the function of each chemical/components below in DNA extraction Salt: Detergent:…
A: Breaking cells open to release the DNA. Separating DNA from proteins and other cellular debris.…
Q: Some restriction enzymes produce DNA fragments with overhanging stretches called sticky ends on each…
A: A restriction enzyme, is an enzyme that cleaves DNA into fragments at or near specific recognition…
Q: Discuss the following statement: “primase is a sloppy enzyme that makes many mistakes. eventually,…
A: Enzymes are biocatalysts that aid in the speeding up of reactions. They are proteins that help to…
Q: Select the CORRECT pairing. DNA polymerase I : links Okazaki fragments together DNA helicase :…
A: DNA polymerase is an enzyme used in the synthesis of new DNA strand in the 5'-3' direction.…
Q: Recombinant DNA Cloning DNA sequencing Polymerase chain reaction Purpose: 14. Purpose: 15. Purpose:…
A: Recombinant DNA technology is the set of techniques that enable the DNA from different sources to be…
Q: DNA replication is semi-conservative; a copy of each strand is made and the new set is inherited to…
A: Semi-conservative replication is a process of replication in which a DNA duplex is formed such that…
Q: Sample Gel Electrophoresis: A brother and sister's DNA are cut with the same restriction enzyme and…
A: Gel electrophoresis is used to separate the DNA fragments on the basis of their size.
Q: Create a 75-nitrogenous base long DNA and replicate it completely. Make sure initiation, elongation…
A: Replication of DNA : DNA replication is the process where a new strand exactly similar to the…
Q: The Sanger method of DNA sequencing follows the principle of complementarity just like in the…
A: Sangers method also known as chain termination method is a method of DNA sequencing.
Q: An enzyme to add nucleotides specifically at the ends of chromosomes would be: Question 6 options:…
A: Chromosomes are the carrier of hereditary DNA molecules and have a thread-like appearance. They are…
Q: Which of the following statements about gel electrophoresis is false? Choose all that apply.…
A: Gel electrophoresis is a technique used in the separation of DNA fragments .
Q: Once the strands have been replicated, the enzyme DNA polymerase I “cleans up” by removing the…
A: In molecular biology,DNA replication is the process in which DNA is replicated. The replicated DNA…
Q: If you need to make a lot up to 1 billion copies of a piece of DNA you would use 1. gel…
A: Polymerase chain reaction is the method of making millions of copies of a specific DNA. It was…
Q: Which of the following best describes the complete sequence of steps occurring during eve cycle of…
A: PCR is an abbreviation for polymerase chain reaction which was developed by the biochemist Kary…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…1B 3/23 DNA/Protein Synt x S le festin song analysis | Scho0 X G what compounds are respons mmon-assessment-delivery/start/4797160920?action3Donresume&submissionld%3D468979669 English 9 Student D.. A Type of Genetics Cr. S TEWWG Chapter 1. ppppppppppppppp. ONA Protein Synthesis Test DNA REPLICATION DNA Replication takes place during v and the end result is 5 67 8 9 10 11 Support Schoology Blog I PRIVACY POLICYerm test Fall 2020 (page 1 of x A elearn.squ.edu.om/mod/quiz/attempt.php?attempt31335328&cmid%3D697149 -aming System (Academic) Fon 3 "DNA is passed from one generation to another during cells division after DNA replication". et red which of the following statements regarding DNA replication is NOT correct: d out of Select one: O a. Each DNA strand of the double helix will be copied g question O b. The newly synthesized strand will have the complementary sequence of the parental template strand O c. The daughter cell will have doub the amount of DNA that the parental cell had n 4 Which of the following ketoses contain the same number of carbons as glucose? ed Select one: out of O a. Sucrose O b. Fructose question O c. Ribose O d. Galactose O e. Aldose 5) helps maintaining the skin's cells and prevents the growth of some
- A Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine ThreonineG-Unit 5: DNA anc X https://docs.goog x y google classroom x A Classes QLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHNOOdqFX_aDbV_6-bKw/formResponse of Distance Le... Launch Meeting - Z.. 4 2020 HORNETS 4N... StudentVUE Clear s How is a protein made in the cell? * One strand of DNA in the ribosome combines with amino acids. Two strands of DNA in the nucleus combine with amino acids. One strand of RNA in the ribosome is the template (model) for an amino acid sequence. Two strands of RNA in the nucleus are the template (model) for an amino acid sequence. Use the chart to determine the correct amino acid that this DNA would code for - ATA EGFL Y. UCAGUCAG Gutame Aspart ac31_30*_SP23 - General Biology I (for m 24 ed out of nove flag evious page A $ Transcribe the following DNA: TACGGGGCTGAGATT Select one: O a. UACGGGGCUGAGAUU O b. Tyr-Gly-Ala-Glu-lle C. Met-Pro-Arg-Leu-STOP O d. AUGCCCCGACUCUAA MacBook Air
- EcoRI --- 5' G - AATTC 3' 5' AGAATTCCGACGTATTAGAATTCTTAT CCGCCGCCGGAATTCT CATCA 3' 3' TCTTAAGGCTGCATAATCTTAAGAATAGGCGGCGGCCTTAAGAGTAGT 5' Number of pieces of DNA , and type of fragment .5 X O https://student.masteryconnect.com/?iv it41199tzPsQ_21hXG6OXABtokesw7jBW 912 Approved Sites SCS 21-22 SCI BIO District CFA2 Perez Jimenez, Dorian 00 4 of 20 The diagram shows the structure of DNA with complementary base pairing between strands. What is the benefit of this complementary nature of DNA? O It helps in controlling the amount of protein produced by the cells. O It helps in storing all the information required for the cell to function efficiently. It helps in the synthesizing of two new identical DNA strands from each parent strand O I t helps in the unwinding of DNA allowing for the formation of chromosomes during mitosis Type here to searchBio1B 3/23 DNA/Protein Syntl X S le festin song analysis | Schoo X G what compounds are re /common-assessment-delivery/start/4797160920?action%3Donresume&submissionld%3D468979669 Ai. English 9 Student D. S ddddddddddddddd... Type of Genetics Cr. S TEWWG Chap DNA Protein Synthesis Test DNA REPLICATION 1. The enzyme is responsible for unzipping the helix to start the process of replication. 2. is responsible for adding new nucleotides to the template strand during replication. 6 7 8 9 10 11 ment-delivery/start/47971609207action-onresume&submissionid-468979669# Support | Schoology Blog | PRIVACY PO
- 08 Nucleoside and nucleotide analogs are two closely related classes of anti-viral drugs that inhibit viral DNA or RNA polymerase enzymes. What is their most common mechanism of action and why are they often referred to as "chain terminators"? Edit View Insert Format Tools Table A xd0 Paragraph v They are referred as chain terminators because the sturcutre when looked at does not contain a 3 prime end 31 8 8:10 EE O 6 n134 LABORATORY Size of the Cell U22T RAJUBAV RO OJA Shape of the Nucleus 916 91032 Degree of Chromatin Condensation Presence or Absence of Nucleoli Cytoplasmic Staining Blood Cells Presence of Cytoplasmic Granules Cytologic/Histologie 18: or cellule Bone Marrow Cells of the develo eveloping cells noil Identi 010Integration of Lambda DNA requires INT XIS both INT and XIS