What is the structure labeled 5 in the following image and explain why it’s correct. 123765 Copyright © 2009 Pearson Education, Inc., publishing as Pearson Benjamin CummingsBoneTendonFascicle● Myofiber

Ans. A muscle is collectively formed by different muscular tissues that create force by contracting…

Answered: 1 2 3 7 6 5

Science

Anatomy and Physiology

1 2 3 7 6 5

Human Anatomy & Physiology (11th Edition)

11th Edition

ISBN:9780134580999

Author:Elaine N. Marieb, Katja N. Hoehn

Publisher:Elaine N. Marieb, Katja N. Hoehn

Chapter1: The Human Body: An Orientation

Section: Chapter Questions

Problem 1RQ: The correct sequence of levels forming the structural hierarchy is A. (a) organ, organ system,...

See similar textbooks

Similar questions

What will happen when Ranitidine is expose in sunlight/ moisture? What molecular changes is form when Ranitidine is expose in sunlight/ moisture? Please explain at your own words .
VizamylTM is used in brain scans for Alzheimer’s disease. Draw the structure of VizamylTM and identify the radioisotope present in the structure. Explain how F-18 differs from F-19.
20 4. A sample containing ethanol and water was found to have n6 = 1.3400. Calculate the exact percentage of ethanol and water in this example. Show your work. (Hint: Solve this mathematically. Assume a linear relationship between concentration and refractive index. You can make the y-intercept the refractive index of water, and use the slope formula to find the slope. The x axis (concentration) will be from 0% ethanol to 100% ethanol. From this information, you can get the equation of the line, then plug in your numbers from there.)
determine the structure of p2 spike. is it primary, secondary, tertiary, or quaternary?
Based on the image below, which three purines are pictured. Be sure to select the correct name and number. NH2 *** HN HN' H₂N 1 2 3 1. Guanine 2. Xanthine 3. Adenine O 1. Adenine 2. Guanine 3. Xanthine O 1. Adenine 2. Guanine 3. Uric acid 1. Guanine 2. Uric acid 3. Adenine ○ 1. Guanine 2. Uracil 3. Adenine
What is the natural polysaccharide whose repeating structure can be symbolized by GlcUAB(1 3)GICNAC, with these units connected by B(1- 4) links?
1) You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide |protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280nm? Select the best answer. a) Measuring absorbance at higher wavelengths, like 595nm or 562nm, is more accurate than measuring absorbance at 280nm. b) The Bradford…
What does this statement mean: "Upon folding of a protein many main chain amides replace their hydrogen bonds to water for those with other amide bonds" Is this true for alpha helix in proline racemase? and is there a pattern?
Consider the structure of the amino acid L-asparagine. Part 1 of 3 Draw the structure of L-asparagine at pH-6. Part 2 of 3 Click and drag to start drawing a structure. Draw the structure of L-asparagine at pH-2. Part 3 of 3 Click and drag to start drawing a structure. Draw the structure of L-asparagine at pH-10. Click and drag to start drawing a structure. 奶+ G D: x 5 x A :0 Q
(a) A protein is found to be a tetramer of identical subunits. Name two symmetries possible for such a molecule. What kinds of interactions (iso logous or heterologous) would stabilize each? (b) Suppose a tetramer, like hemoglobin, consists of two each of two types of subunits, a and B. What is the highest symmetry now possible?
How do you draw the resolution to the double Holliday junction? Each step explained in detail.
What are the structural differences between bilirubin and urobilin? (Select all that apply.) O Ring is opened in the first compound, but is not in the second compound. Several methylene bridges are reduced in the second compound. O Iron atom is absent in the second compound, but is present in the first compound. The central methylene bridge is reduced in the second compound, but is not in the first compound. O Ring is opened in the second compound, but is not in the first compound. Some vinyl groups are reduced into ethyl groups in the second compound. The central methylene bridge is oxidised in the second compound, but is not in the first compound. O Some vinyl groups are reduced into ethyl groups in the first compound.